Basic Vector Information
- Vector Name:
- pHcRed1-1
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4118 bp
- Type:
- Fluorescent Protein Genes & Plasmids
- Replication origin:
- ori
- Source/Author:
- Clontech
- Selection Marker:
- Neomycin/G418(Geneticin)
- Copy Number:
- High copy number
- Promoter:
- SV40
pHcRed1-1 vector Vector Map
pHcRed1-1 vector Sequence
LOCUS 40924_24358 4118 bp DNA circular SYN 01-JAN-1980 DEFINITION Promoterless HcRed1 reporter vector. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4118) AUTHORS Clontech TITLE Direct Submission REFERENCE 2 (bases 1 to 4118) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" COMMENT Can be used to monitor transcription from a promoter inserted into the MCS. FEATURES Location/Qualifiers source 1..4118 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature 9..89 /label=MCS /note="multiple cloning site" CDS 97..780 /codon_start=1 /label=HcRed1 /note="far-red fluorescent variant of Heteractis crispa chromoprotein" /translation="MVSGLLKESMRIKMYMEGTVNGHYFKCEGEGDGNPFAGTQSMRIH VTEGAPLPFAFDILAPCCEYGSRTFVHHTAEIPDFFKQSFPEGFTWERTTTYEDGGILT AHQDTSLEGNCLIYKVKVHGTNFPADGPVMKNKSGGWEPSTEVVYPENGVLCGRNVMAL KVGDRHLICHHYTSYRSKKAVRALTMPGFHFTDIRLQMLRKKKDEYFELYEASVARYSD LPEKAN" polyA_signal 906..1027 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" rep_origin complement(1034..1489) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 1516..1620 /label=AmpR promoter promoter 1622..1979 /label=SV40 promoter /note="SV40 enhancer and early promoter" CDS 2014..2805 /codon_start=1 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF" polyA_signal 3040..3087 /label=HSV TK poly(A) signal /note="herpes simplex virus thymidine kinase polyadenylation signal (Cole and Stacy, 1985)" rep_origin 3416..4004 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.