Basic Vector Information
- Vector Name:
- pLSSmOrange-N1
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4723 bp
- Type:
- Fluorescent Protein Genes & Plasmids
- Replication origin:
- ori
- Source/Author:
- Shcherbakova DM, Hink MA, Joosen L, Gadella TW, Verkhusha VV.
- Selection Marker:
- Neomycin/G418(Geneticin)
- Copy Number:
- High copy number
- Promoter:
- CMV
pLSSmOrange-N1 vector Map
pLSSmOrange-N1 vector Sequence
LOCUS 40924_28771 4723 bp DNA circular SYN 01-JAN-1980 DEFINITION Vector for fusing LSSmOrange to the C-terminus of a partner protein. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4723) AUTHORS Shcherbakova DM, Hink MA, Joosen L, Gadella TW, Verkhusha VV. TITLE An orange fluorescent protein with a large Stokes shift for single-excitation multicolor FCCS and FRET imaging. JOURNAL J. Am. Chem. Soc. 2012;134:7913-23. PUBMED 22486524 REFERENCE 2 (bases 1 to 4723) AUTHORS Verkhusha Lab TITLE Direct Submission REFERENCE 3 (bases 1 to 4723) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "J. Am. Chem. Soc."; date: "2012"; volume: "134"; pages: "7913-23" COMMENT SGRef: number: 2; type: "Journal Article" FEATURES Location/Qualifiers source 1..4723 /mol_type="other DNA" /organism="synthetic DNA construct" enhancer 61..364 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" promoter 365..568 /label=CMV promoter /note="human cytomegalovirus (CMV) immediate early promoter" misc_feature 591..671 /label=MCS /note="multiple cloning site" CDS 679..1386 /codon_start=1 /label=LSSmOrange /note="monomeric orange fluorescent protein with a large Stokes shift (Shcherbakova et al., 2012)" /translation="MVSKGEENNMAIIKEFMRFKVRMEGSVNGHEFEIEGEGEGRPYEG FQTVKLKVTKGGPLPFAWDILSPQFTYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNF EDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGMEASSERMYPEDGALK GEDKLRLKLKDGGHYTSEVKTTYKAKKPVQLPGAYIVDIKLDITSHNEDYTIVEQYERA EGRHSTGGMDELYK" polyA_signal 1511..1632 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" rep_origin complement(1639..2094) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 2121..2225 /label=AmpR promoter promoter 2227..2584 /label=SV40 promoter /note="SV40 enhancer and early promoter" CDS 2619..3410 /codon_start=1 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF" polyA_signal 3645..3692 /label=HSV TK poly(A) signal /note="herpes simplex virus thymidine kinase polyadenylation signal (Cole and Stacy, 1985)" rep_origin 4021..4609 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.