Basic Vector Information
- Vector Name:
- pNirFP-C
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4716 bp
- Type:
- Fluorescent Protein Genes & Plasmids
- Replication origin:
- ori
- Source/Author:
- Evrogen
- Selection Marker:
- Neomycin/G418(Geneticin)
- Copy Number:
- High copy number
pNirFP-C vector Map
pNirFP-C vector Sequence
LOCUS 40924_33282 4716 bp DNA circular SYN 01-JAN-1980 DEFINITION Vector for fusing NirFP to the N-terminus of a partner protein. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4716) AUTHORS Evrogen TITLE Direct Submission REFERENCE 2 (bases 1 to 4716) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" FEATURES Location/Qualifiers source 1..4716 /mol_type="other DNA" /organism="synthetic DNA construct" enhancer 61..364 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" promoter 365..568 /label=CMV promoter /note="human cytomegalovirus (CMV) immediate early promoter" CDS 613..1314 /codon_start=1 /label=NirFP /note="near-infrared fluorescent protein eqFP670" /translation="MGEDSELISENMHTKLYMEGTVNGHHFKCTSEGEGKPYEGTQTCK IKVVEGGPLPFAFDILATSFMYGSKTFINHTQGIPDFFKQSFPEGFTWERITTYEDGGV LTATQDTSLQNGCLIYNVKINGVNFPSNGPVMQKKTLGWEANTEMLYPADSGLRGHNQM ALKLVGGGYLHCSLKTTYRSKKPAKNLKMPGFYFVDRKLERIKEADKETYVEQHEMAVA RYCDLPSKLGHS" misc_feature 1315..1380 /label=MCS /note="multiple cloning site" polyA_signal 1504..1625 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" rep_origin complement(1632..2087) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 2114..2218 /label=AmpR promoter promoter 2220..2577 /label=SV40 promoter /note="SV40 enhancer and early promoter" CDS 2612..3403 /codon_start=1 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF" polyA_signal 3638..3685 /label=HSV TK poly(A) signal /note="herpes simplex virus thymidine kinase polyadenylation signal (Cole and Stacy, 1985)" rep_origin 4014..4602 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.