Basic Vector Information
- Vector Name:
- pPhi-Yellow-N
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4778 bp
- Type:
- Fluorescent Protein Genes & Plasmids
- Replication origin:
- ori
- Source/Author:
- Evrogen
- Selection Marker:
- Neomycin/G418(Geneticin)
- Copy Number:
- High copy number
pPhi-Yellow-N vector Vector Map
pPhi-Yellow-N vector Sequence
LOCUS 40924_34460 4778 bp DNA circular SYN 01-JAN-1980 DEFINITION Vector for fusing PhiYFP to the C-terminus of a partner protein. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4778) AUTHORS Evrogen TITLE Direct Submission REFERENCE 2 (bases 1 to 4778) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" FEATURES Location/Qualifiers source 1..4778 /mol_type="other DNA" /organism="synthetic DNA construct" enhancer 61..364 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" promoter 365..568 /label=CMV promoter /note="human cytomegalovirus (CMV) immediate early promoter" misc_feature 591..671 /label=MCS /note="multiple cloning site" CDS 679..1380 /codon_start=1 /label=PhiYFP /note="Phialidium yellow fluorescent proteim" /translation="MSSGALLFHGKIPYVVEMEGNVDGHTFSIRGKGYGDASVGKVDAQ FICTTGDVPVPWSTLVTTLTYGAQCFAKYGPELKDFYKSCMPDGYVQERTITFEGDGNF KTRAEVTFENGSVYNRVKLNGQGFKKDGHVLGKNLEFNFTPHCLYIWGDQANHGLKSAF KICHEITGSKGDFIVADHTQMNTPIGGGPVHVPEYHHMSYHVKLSKDVTDHRDNMSLKE TVRAVDCRKTYL" polyA_signal 1566..1687 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" rep_origin complement(1694..2149) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 2176..2280 /label=AmpR promoter promoter 2282..2639 /label=SV40 promoter /note="SV40 enhancer and early promoter" CDS 2674..3465 /codon_start=1 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF" polyA_signal 3700..3747 /label=HSV TK poly(A) signal /note="herpes simplex virus thymidine kinase polyadenylation signal (Cole and Stacy, 1985)" rep_origin 4076..4664 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.