Basic Vector Information
- Vector Name:
- pPSmOrange-N1
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4724 bp
- Type:
- Fluorescent Protein Genes & Plasmids
- Replication origin:
- ori
- Source/Author:
- Subach OM, Patterson GH, Ting LM, Wang Y, Condeelis JS, Verkhusha
- Selection Marker:
- Neomycin/G418(Geneticin)
- Copy Number:
- High copy number
pPSmOrange-N1 vector Vector Map
pPSmOrange-N1 vector Sequence
LOCUS 40924_35579 4724 bp DNA circular SYN 01-JAN-1980 DEFINITION Vector for fusing PSmOrange to the C-terminus of a partner protein. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4724) AUTHORS Subach OM, Patterson GH, Ting LM, Wang Y, Condeelis JS, Verkhusha VV. TITLE A photoswitchable orange-to-far-red fluorescent protein, PSmOrange. JOURNAL Nat. Methods 2011;8:771-7. PUBMED 21804536 REFERENCE 2 (bases 1 to 4724) AUTHORS Verkhusha Lab TITLE Direct Submission REFERENCE 3 (bases 1 to 4724) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat. Methods"; date: "2011"; volume: "8"; pages: "771-7" COMMENT SGRef: number: 2; type: "Journal Article" FEATURES Location/Qualifiers source 1..4724 /mol_type="other DNA" /organism="synthetic DNA construct" enhancer 61..364 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" promoter 365..568 /label=CMV promoter /note="human cytomegalovirus (CMV) immediate early promoter" misc_feature 591..671 /label=MCS /note="multiple cloning site" CDS 679..1386 /codon_start=1 /label=PSmOrange /note="orange to far-red photoswitchable variant of the monomeric fluorescent protein mOrange (Subach et al., 2011)" /translation="MVSKGEENNMAIIKEFMRFKVRMEGTVNGHEFEIEGEGEGRPYEG FQTAKLKVTKGGPLPFAWDILSPLFTYGSKAYVKHPADIPDYFKLSFPEGFKWERVMNY EDGGVVTVTQDSSLQDGEFIYKVKMRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALK GEIRMRLKLKDGGHYTSEVKTTYKAKKSVQLPGAYIVGIKLDITSHNEDYTIVEQYERA EGRHSTGGMDELYK" polyA_signal 1512..1633 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" rep_origin complement(1640..2095) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 2122..2226 /label=AmpR promoter promoter 2228..2585 /label=SV40 promoter /note="SV40 enhancer and early promoter" CDS 2620..3411 /codon_start=1 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF" polyA_signal 3646..3693 /label=HSV TK poly(A) signal /note="herpes simplex virus thymidine kinase polyadenylation signal (Cole and Stacy, 1985)" rep_origin 4022..4610 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.