Basic Vector Information
- Vector Name:
- pTurboRFP-PRL
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4127 bp
- Type:
- Fluorescent Protein Genes & Plasmids
- Replication origin:
- ori
- Source/Author:
- Evrogen
- Selection Marker:
- Neomycin/G418(Geneticin)
- Copy Number:
- High copy number
- Promoter:
- SV40
pTurboRFP-PRL vector Vector Map
pTurboRFP-PRL vector Sequence
LOCUS 40924_44479 4127 bp DNA circular SYN 01-JAN-1980 DEFINITION Promoterless TurboRFP reporter vector. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4127) AUTHORS Evrogen TITLE Direct Submission REFERENCE 2 (bases 1 to 4127) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" COMMENT Can be used to monitor transcription from a promoter inserted into the MCS. FEATURES Location/Qualifiers source 1..4127 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature 9..89 /label=MCS /note="multiple cloning site" CDS 97..789 /codon_start=1 /label=TurboRFP /note="red fluorescent protein from Entacmaea quadricolor" /translation="MSELIKENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMKIKV VEGGPLPFAFDILATSFMYGSKAFINHTQGIPDFFKQSFPEGFTWERITTYEDGGVLTA TQDTSFQNGCIIYNVKINGVNFPSNGPVMQKKTRGWEANTEMLYPADGGLRGHSQMALK LVGGGYLHCSFKTTYRSKKPAKNLKMPGFHFVDHRLERIKEADKETYVEQHEMAVAKYC DLPSKLGHR" polyA_signal 915..1036 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" rep_origin complement(1043..1498) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 1525..1629 /label=AmpR promoter promoter 1631..1988 /label=SV40 promoter /note="SV40 enhancer and early promoter" CDS 2023..2814 /codon_start=1 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF" polyA_signal 3049..3096 /label=HSV TK poly(A) signal /note="herpes simplex virus thymidine kinase polyadenylation signal (Cole and Stacy, 1985)" rep_origin 3425..4013 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.