Basic Vector Information
pDONR221 is a cloning vector, with attP1 and attP2 sites and a kanamycin resistance marker.
- Vector Name:
- pDONR221
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 4761 bp
- Type:
- Gateway Cloning Vectors
- Replication origin:
- ori
- Source/Author:
- Invitrogen (Life Technologies)
- Copy Number:
- High copy number
- 5' Primer:
- M13 fwd
- 3' Primer:
- M13 rev
pDONR221 vector Map
References
- Kropp KN, Schäufele TJ, Fatho M, Volkmar M, Conradi R, Theobald M, Wölfel T, Wölfel C. A bicistronic vector backbone for rapid seamless cloning and chimerization of αβT-cell receptor sequences. PLoS One. 2020 Sep 9;15(9):e0238875.
pDONR221 vector Sequence
LOCUS Exported 4761 bp DNA circular SYN 13-DEC-2024 DEFINITION synthetic circular DNA ACCESSION . VERSION . KEYWORDS pDONR221 SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4761) AUTHORS 11111111 TITLE Direct Submission FEATURES Location/Qualifiers source 1..4761 /mol_type="other DNA" /organism="synthetic DNA construct" terminator 268..295 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" terminator 387..473 /gene="Escherichia coli rrnB" /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" primer_bind 537..553 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" protein_bind 570..801 /gene="mutant version of attP" /label=attP1 /bound_moiety="BP Clonase(TM)" /note="recombination site for the Gateway(R) BP reaction (pDONR(TM)221 version)" CDS complement(1197..1502) /codon_start=1 /gene="ccdB" /product="CcdB, a bacterial toxin that poisons DNA gyrase" /label=ccdB /note="Plasmids containing the ccdB gene cannot be propagated in standard E. coli strains." /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK VSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI" CDS complement(1852..2505) /codon_start=1 /gene="cat" /product="chloramphenicol acetyltransferase" /label=CmR /note="confers resistance to chloramphenicol" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGG" promoter complement(2506..2608) /label=cat promoter /note="promoter of the E. coli cat gene" protein_bind complement(2753..2984) /gene="mutant version of attP" /label=attP2 /bound_moiety="BP Clonase(TM)" /note="recombination site for the Gateway(R) BP reaction (pDONR(TM)221 version)" promoter complement(3003..3021) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(3026..3042) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" CDS 3155..3964 /codon_start=1 /gene="aph(3')-Ia" /product="aminoglycoside phosphotransferase" /label=KanR /note="confers resistance to kanamycin in bacteria or G418 (Geneticin(R)) in eukaryotes" /translation="MSHIQRETSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYGKP DAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGKTA FQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASD FDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIAD RYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" rep_origin 4111..4699 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.