Basic Vector Information
- Vector Name:
- pENTR/GeneBLAzer
- Antibiotic Resistance:
- Kanamycin
- Length:
- 3339 bp
- Type:
- Gateway Cloning Vectors
- Replication origin:
- ori
- Source/Author:
- Invitrogen (Life Technologies)
- Copy Number:
- High copy number
pENTR/GeneBLAzer vector Map
pENTR/GeneBLAzer vector Sequence
LOCUS 40924_17468 3339 bp DNA circular SYN 01-JAN-1980 DEFINITION Gateway(R) entry clone to be used as a control for fluorescence detection of beta-lactamase with the GeneBLAzer(R) system. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3339) AUTHORS Invitrogen (Life Technologies) TITLE Direct Submission REFERENCE 2 (bases 1 to 3339) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" FEATURES Location/Qualifiers source 1..3339 /mol_type="other DNA" /organism="synthetic DNA construct" terminator complement(268..295) /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" terminator complement(387..473) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" primer_bind 537..553 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" protein_bind 569..667 /label=attL1 /note="recombination site for the Gateway(R) LR reaction" CDS 671..1462 /codon_start=1 /label=bla(M) /note="beta-lactamase lacking the signal sequence" /translation="MDPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMM STFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAIT MSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPVAMA TTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGII AALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW" protein_bind complement(1464..1563) /label=attL2 /note="recombination site for the Gateway(R) LR reaction" promoter complement(1581..1599) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(1604..1620) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" CDS 1733..2539 /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYGKP DAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGKTA FQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASD FDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIAD RYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" rep_origin 2689..3277 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.