Basic Vector Information
- Vector Name:
- pHELLSGATE 4
- Antibiotic Resistance:
- Kanamycin
- Length:
- 17861 bp
- Type:
- Gateway Cloning Vectors
- Replication origin:
- oriV
- Host:
- Plants
- Source/Author:
- Helliwell CA, Wesley SV, Wielopolska AJ, Waterhouse PM.
- Copy Number:
- High copy number
- Promoter:
- CaMV 35S
pHELLSGATE 4 vector Map
pHELLSGATE 4 vector Sequence
LOCUS pHELLSGATE_4. 17861 bp DNA circular SYN 01-JAN-1980 DEFINITION Improved high-throughput binary Gateway(R) donor vector for silencing genes in plants using intron-containing hairpin RNA. ACCESSION . VERSION . KEYWORDS pHELLSGATE 4 SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 17861) AUTHORS Helliwell CA, Wesley SV, Wielopolska AJ, Waterhouse PM. TITLE High-throughput vectors for efficient gene silencing in plants. JOURNAL Funct. Plant Biol. 2002;29:1217-25. REFERENCE 2 (bases 1 to 17861) TITLE Direct Submission REFERENCE 3 (bases 1 to 17861) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Funct. Plant Biol."; date: "2002"; volume: "29"; pages: "1217-25" COMMENT SGRef: number: 2; type: "Journal Article" FEATURES Location/Qualifiers source 1..17861 /mol_type="other DNA" /organism="synthetic DNA construct" promoter complement(65..83) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(90..106) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 264..447 /label=NOS promoter /note="nopaline synthase promoter" CDS 448..1266 /label=KanR /note="fusion between an N-terminal peptide of nopaline synthase and Tn5 aminoglycoside phosphotransferase" terminator 1894..2146 /label=NOS terminator /note="nopaline synthase terminator and poly(A) signal" misc_feature complement(2268..2292) /label=LB T-DNA repeat /note="left border repeat from nopaline C58 T-DNA" oriT 2846..2955 /label=oriT /note="incP origin of transfer" mobile_element 3015..3782 /label=IS1 /note="prokaryotic transposable element" CDS 3782..4132 /label=traJ /note="oriT-recognizing protein" CDS 4407..5552 /label=trfA /note="trans-acting replication protein that binds to and activates oriV" rep_origin complement(6915..7503) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS 8600..9388 /codon_start=1 /gene="aadA" /product="aminoglycoside adenylyltransferase" /label=aadA /note="SmR" /note="confers resistance to spectinomycin and streptomycin" /translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP VILEARQAYLGQEDRLASRADQLEEFVHYVKGEITKVVGK" rep_origin complement(9993..10705) /direction=LEFT /label=oriV /note="incP origin of replication" misc_feature complement(11182..11206) /label=RB T-DNA repeat /note="right border repeat from nopaline C58 T-DNA" protein_bind 11462..11483 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 11498..11528 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 11536..11552 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 11560..11576 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" promoter 11594..11612 /label=SP6 promoter /note="promoter for bacteriophage SP6 RNA polymerase" promoter 12672..13017 /label=CaMV 35S promoter /note="strong constitutive promoter from cauliflower mosaic virus" protein_bind 13048..13279 /label=attP1 /note="recombination site for the Gateway(R) BP reaction" CDS complement(13678..13980) /label=ccdB /note="CcdB, a bacterial toxin that poisons DNA gyrase" protein_bind complement(14387..14618) /label=attP2 /note="recombination site for the Gateway(R) BP reaction (pDONR(TM)221 version)" misc_feature 14644..14654 /label=MCS 1 /note="MCS 1" /note="multiple cloning site 1" intron 14662..15428 /label=PDK intron /note="pyruvate orthophosphate dikinase intron from Flaveria trinervia" misc_feature 15448..15454 /label=MCS 2 /note="MCS 2" /note="multiple cloning site 2" protein_bind 15490..15721 /label=attP2 /note="recombination site for the Gateway(R) BP reaction (pDONR(TM)221 version)" CDS complement(16028..16330) /label=ccdB /note="CcdB, a bacterial toxin that poisons DNA gyrase" protein_bind complement(16829..17060) /label=attP1 /note="recombination site for the Gateway(R) BP reaction" terminator 17092..17798 /label=OCS terminator /note="octopine synthase terminator" promoter complement(17839..17857) /label=SP6 promoter /note="promoter for bacteriophage SP6 RNA polymerase"
This page is informational only.