Basic Vector Information
- Vector Name:
- pOTB7a
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 1804 bp
- Type:
- I.M.A.G.E. Consortium Plasmids
- Replication origin:
- ori
- Source/Author:
- I.M.A.G.E. Consortium
- Copy Number:
- High copy number
- 5' Primer:
- M13 fwd
- 3' Primer:
- M13 fwd
pOTB7a vector Map
pOTB7a vector Sequence
LOCUS 40924_33957 1804 bp DNA circular SYN 01-JAN-1980 DEFINITION cDNA cloning vector derived from pOTB7. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 1804) AUTHORS I.M.A.G.E. Consortium TITLE Direct Submission REFERENCE 2 (bases 1 to 1804) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" FEATURES Location/Qualifiers source 1..1804 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 53..71 /label=SP6 promoter /note="promoter for bacteriophage SP6 RNA polymerase" protein_bind 85..109 /label=attB1 /note="recombination site for the Gateway(R) BP reaction" primer_bind 111..127 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" protein_bind complement(243..266) /label=attB2 /note="recombination site for the Gateway(R) BP reaction" promoter complement(282..300) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" rep_origin 404..992 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS 1133..1789 /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"
This page is informational only.