Basic Vector Information
- Vector Name:
- pAc5.1/V5-His C
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5371 bp
- Type:
- Insect Cell Vectors
- Replication origin:
- ori
- Source/Author:
- Invitrogen (Life Technologies)
- Copy Number:
- High copy number
- Promoter:
- Ac5
pAc5.1/V5-His C vector Vector Map
pAc5.1/V5-His C vector Sequence
LOCUS 40924_3631 5371 bp DNA circular SYN 01-JAN-1980 DEFINITION Vector for constitutive expression of C-terminally V5-6xHis-tagged proteins in insect cells. For other reading frames, use pAc5.1/V5-His A or pAc5.1/V5-His B. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5371) AUTHORS Invitrogen (Life Technologies) TITLE Direct Submission REFERENCE 2 (bases 1 to 5371) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" COMMENT To create stable cell lines, co-transfect with the drug selection vector pCoHygro or pCoBlast. FEATURES Location/Qualifiers source 1..5371 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 56..2568 /label=Ac5 promoter /note="Drosophila melanogaster actin 5C promoter" CDS 2656..2697 /codon_start=1 /label=V5 tag /note="epitope tag from simian virus 5" /translation="GKPIPNPLLGLDST" CDS 2707..2724 /codon_start=1 /label=6xHis /note="6xHis affinity tag" /translation="HHHHHH" polyA_signal complement(2797..2931) /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" rep_origin complement(3553..4141) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(4315..5172) /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" promoter complement(5173..5277) /label=AmpR promoter
This page is informational only.