Basic Vector Information
- Vector Name:
- pIZT/V5-His
- Antibiotic Resistance:
- Bleomycin
- Length:
- 3336 bp
- Type:
- Insect Cell Vectors
- Replication origin:
- ori
- Source/Author:
- Invitrogen (Life Technologies)
- Copy Number:
- High copy number
- Promoter:
- OpIE-2
pIZT/V5-His vector Map
pIZT/V5-His vector Sequence
LOCUS pIZT_V5-His. 3336 bp DNA circular SYN 01-JAN-1980 DEFINITION Insect cell vector with a GFP-Zeocin(TM) resistance fusion gene, for constitutive expression of proteins with an optional C-terminal V5-6xHis tag. ACCESSION . VERSION . KEYWORDS pIZT V5-His SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3336) AUTHORS Invitrogen (Life Technologies) TITLE Direct Submission REFERENCE 2 (bases 1 to 3336) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" FEATURES Location/Qualifiers source 1..3336 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 5..552 /label=OpIE-2 promoter /note="strong constitutive baculovirus promoter for insect cell expression" misc_feature 567..656 /label=MCS /note="MCS" /note="multiple cloning site" CDS 663..704 /label=V5 tag /note="epitope tag from simian virus 5" CDS 714..731 /label=6xHis /note="6xHis affinity tag" polyA_signal 749..878 /label=OpIE-2 poly(A) signal /note="baculovirus polyadenylation signal" rep_origin complement(1006..1594) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" promoter 1669..1960 /label=OpIE-1 promoter /note="moderate constitutive baculovirus promoter for insect cell expression" promoter 1986..2033 /label=EM7 promoter /note="synthetic bacterial promoter" CDS 2052..2054 /codon_start=1 /product="start codon" /label=start codon /note="ATG" /translation="M" CDS 2067..2771 /label=Cycle 3 GFP /note="Cycle 3 GFP (Crameri et al., 1996)" CDS 2766..3143 /codon_start=1 /gene="Sh ble from Streptoalloteichus hindustanus" /product="antibiotic-binding protein" /label=Sh ble from Streptoalloteichus hindustanus /note="BleoR" /note="confers resistance to bleomycin, phleomycin, and Zeocin(TM)" /translation="MDAKLTSAVPVLTARDVAGAVEFWTDRLGFSRDFVEDDFAGVVRD DVTLFISAVQDQVVPDNTLAWVWVRGLDELYAEWSEVVSTNFRDASGPAMTEIGEQPWG REFALRDPAGNCVHFVAEEQD" polyA_signal 3207..3336 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal"
This page is informational only.