Basic Vector Information
- Vector Name:
- pMelBac C
- Antibiotic Resistance:
- Ampicillin
- Length:
- 4829 bp
- Type:
- Insect Cell Vectors
- Replication origin:
- ori
- Source/Author:
- Invitrogen (Life Technologies)
- Copy Number:
- High copy number
- Promoter:
- polyhedrin
pMelBac C vector Map
pMelBac C vector Sequence
LOCUS pMelBac_C. 4829 bp DNA circular SYN 01-JAN-1980 DEFINITION Baculovirus transfer vector for expression and secretion of recombinant proteins. For other reading frames, use pMelBac A or pMelBac B. ACCESSION . VERSION . KEYWORDS pMelBac C SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4829) AUTHORS Invitrogen (Life Technologies) TITLE Direct Submission REFERENCE 2 (bases 1 to 4829) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" COMMENT Exclusively for use with Bac-N-Blue(TM) DNA. FEATURES Location/Qualifiers source 1..4829 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 4..95 /label=polyhedrin promoter /note="promoter for the baculovirus polyhedrin gene" sig_peptide 96..158 /label=melittin signal sequence /note="signal sequence from honeybee melittin" misc_feature 166..221 /label=MCS /note="MCS" /note="multiple cloning site" misc_recomb 233..938 /label=baculovirus recombination region (ORF1629) /note="contains part of ORF1629" promoter 1514..1618 /label=AmpR promoter CDS 1619..2476 /label=AmpR /note="beta-lactamase" rep_origin 2650..3238 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(3415..4517) /codon_start=3 /gene="lacZ (truncated)" /product="N-terminal fragment of beta-galactosidase" /label=lacZ (truncated) /note="5' lacZ fragment" /translation="VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS LNGEWRFAWFPAPEAVPESWLECDLPEADTVVVPSNWQMHGYDAPIYTNVTYPITVNPP FVPTENPTGCYSLTFNVDESWLQEGQTRIIFDGVNSAFHLWCNGRWVGYGQDSRLPSEF DLSAFLRAGENRLAVMVLRWSDGSYLEDQDMWRMSGIFRDVSLLHKPTTQISDFHVATR FNDDFSRAVLEAEVQMCGELRDYLRVTVSLWQGETQVASGTAPFGGEIIDERGGYTDRV TLRLNVENPKLWSAEIPNLYRAVVELHTADGTLIEAEACDVGFREVRIENGLLLLNGKP LLIRGVNRHEHHPLHGQVMDEQTMVQD" CDS complement(4525..4614) /codon_start=1 /gene="Autographa californica Ac-pcna" /product="proliferating cell nuclear antigen (PCNA) from baculovirus" /label=Autographa californica Ac-pcna /note="Ac PCNA" /translation="MHARLNKSSHRRRKISCIKEQLQLESLLKM" promoter complement(4615..4829) /note="ETL promoter" /note="baculovirus early-to-late promoter (Liu et al., 2006)"
This page is informational only.