Basic Vector Information
- Vector Name:
- pMetLuc-Mem Control
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4764 bp
- Type:
- Luciferase Vectors
- Replication origin:
- ori
- Source/Author:
- Clontech
- Selection Marker:
- Neomycin/G418(Geneticin)
- Copy Number:
- High copy number
- Promoter:
- CMV
pMetLuc-Mem Control vector Map
pMetLuc-Mem Control vector Sequence
LOCUS pMetLuc-Mem_Cont 4764 bp DNA circular SYN 01-JAN-1980 DEFINITION In vivo imaging vector for the constitutive expression of membrane-anchored Metridia luciferase. ACCESSION . VERSION . KEYWORDS pMetLuc-Mem Control SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4764) AUTHORS Clontech TITLE Direct Submission REFERENCE 2 (bases 1 to 4764) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" FEATURES Location/Qualifiers source 1..4764 /mol_type="other DNA" /organism="synthetic DNA construct" enhancer 61..364 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" promoter 365..568 /label=CMV promoter /note="human cytomegalovirus (CMV) immediate early promoter" CDS 597..599 /codon_start=1 /product="start codon" /label=start codon /note="ATG" /translation="M" CDS 603..788 /codon_start=1 /product="signal-anchor region of the transferrin receptor" /label=signal-anchor region of the transferrin receptor /note="TfR membrane anchor" /translation="VDGDNSHVEMKLAVDEEENADNNTKANVTKPKRCSGSICYGTIAV IVFFLIGFMIGYLGYCK" CDS 822..1427 /codon_start=1 /product="Metridia luciferase" /label=Metridia luciferase /note="MetLuc" /note="human codon-optimized" /translation="KSTEFDPNIDIVGLEGKFGITNLETDLFTIWETMEVMIKADIADT DRASNFVATETDANRGKMPGKKLPLAVIMEMEANAFKAGCTRGCLICLSKIKCTAKMKV YIPGRCHDYGGDKKTGQAGIVGAIVDIPEISGFKEMAPMEQFIAQVDRCASCTTGCLKG LANVKCSELLKKWLPDRCASFADKIQKEVHNIKGMAGDR" polyA_signal 1552..1673 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" rep_origin complement(1680..2135) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 2162..2266 /label=AmpR promoter promoter 2268..2625 /label=SV40 promoter /note="SV40 enhancer and early promoter" CDS 2660..3451 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" polyA_signal 3686..3733 /label=HSV TK poly(A) signal /note="herpes simplex virus thymidine kinase polyadenylation signal (Cole and Stacy, 1985)" rep_origin 4062..4650 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.