Basic Vector Information
- Vector Name:
- pSELECT-zeo-Lucia
- Antibiotic Resistance:
- Bleomycin
- Length:
- 3769 bp
- Type:
- Luciferase Vectors
- Replication origin:
- ori
- Source/Author:
- InvivoGen
- Copy Number:
- High copy number
- Promoter:
- EF-1α core
pSELECT-zeo-Lucia vector Vector Map
pSELECT-zeo-Lucia vector Sequence
LOCUS pSELECT-zeo-Luci 3769 bp DNA circular SYN 01-JAN-1980 DEFINITION Mammalian vector for the expression of secreted Lucia(R) luciferase. ACCESSION . VERSION . KEYWORDS pSELECT-zeo-Lucia SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3769) AUTHORS InvivoGen TITLE Direct Submission REFERENCE 2 (bases 1 to 3769) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" FEATURES Location/Qualifiers source 1..3769 /mol_type="other DNA" /organism="synthetic DNA construct" polyA_signal 9..57 /label=poly(A) signal /note="synthetic polyadenylation signal" misc_feature 68..159 /label=pause site /note="RNA polymerase II transcriptional pause signal from the human alpha-2 globin gene" promoter 196..407 /label=EF-1-alpha core promoter /note="core promoter for human elongation factor EF-1-alpha" LTR 420..688 /label=5' LTR (truncated) /note="truncated 5' long terminal repeat (LTR) from human T-cell leukemia virus (HTLV) type 1" CDS 728..1357 /codon_start=1 /product="secreted coelenterazine-utilizing luciferase" /label=secreted coelenterazine-utilizing luciferase /note="Lucia(R)" /note="synthetic gene based on luciferases from marine copepods" /translation="MEIKVLFALICIAVAEAKPTEINEDLNIAAVASNFATTDLETDLF TNWETMNVISTDTEQVNTDADRGKLPGKKLPPDVLRELEANARRAGCTRGCLICLSHIK CTPKMKKFIPGRCHTYEGEKESAQGGIGEAIVDIPEIPGFKDKEPLDQFIAQVDLCADC TTGCLKGLANVQCSDLLKKWLPQRCTTFASKIQGRVDKIKGLAGDR" polyA_signal complement(1379..1500) /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" polyA_signal complement(1600..1994) /label=beta-globin poly(A) /note="human beta-globin polyadenylation signal" CDS complement(2011..2382) /label=BleoR /note="antibiotic-binding protein" promoter complement(2402..2449) /label=EM7 promoter /note="synthetic bacterial promoter" promoter complement(2495..2698) /label=CMV promoter /note="human cytomegalovirus (CMV) immediate early promoter" enhancer complement(2699..3002) /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" rep_origin complement(3082..3670) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.