Basic Vector Information
- Vector Name:
- pEZSeq-Kan
- Antibiotic Resistance:
- Kanamycin
- Length:
- 2008 bp
- Type:
- Lucigen Vectors
- Replication origin:
- ori
- Source/Author:
- Lucigen
- Copy Number:
- High copy number
pEZSeq-Kan vector Map
pEZSeq-Kan vector Sequence
LOCUS 40924_18996 2008 bp DNA circular SYN 01-JAN-1980 DEFINITION Blue/white screening vector with a kanamycin resistance marker for high efficiency blunt end cloning. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 2008) AUTHORS Lucigen TITLE Direct Submission REFERENCE 2 (bases 1 to 2008) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" COMMENT Linearize at HincII to make blunt cloning vector. FEATURES Location/Qualifiers source 1..2008 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 18..48 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 56..72 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 80..96 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" primer_bind complement(127..143) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" terminator 324..355 /label=tonB terminator /note="bidirectional E. coli tonB-P14 transcription terminator" promoter 356..458 /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" CDS 459..1271 /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNGDRVFRLAQAQSRMNNGLVGA SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" terminator 1295..1322 /label=T7Te terminator /note="phage T7 early transcription terminator" rep_origin complement(1334..1921) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" terminator complement(1943..1972) /label=T3Te terminator /note="phage T3 early transcription terminator"
This page is informational only.