Basic Vector Information
- Vector Name:
- pRANGER-BTB-1
- Antibiotic Resistance:
- Ampicillin
- Length:
- 3784 bp
- Type:
- Lucigen Vectors
- Replication origin:
- pBBR1 oriV
- Source/Author:
- Lynch MD, Gill RT.
- Copy Number:
- Medium copy number
- Promoter:
- araBAD
pRANGER-BTB-1 vector Vector Map
pRANGER-BTB-1 vector Sequence
LOCUS 40924_36358 3784 bp DNA circular SYN 01-JAN-1980 DEFINITION Broad host range expression vector with an ampicillin resistance marker and with the pBBR1 replicon for Gram-negative bacteria. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3784) AUTHORS Lynch MD, Gill RT. TITLE Broad host range vectors for stable genomic library construction. JOURNAL Biotechnol. Bioeng. 2006;94:151-8. PUBMED 16496398 REFERENCE 2 (bases 1 to 3784) AUTHORS Lucigen TITLE Direct Submission REFERENCE 3 (bases 1 to 3784) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Biotechnol. Bioeng."; date: "2006"; volume: "94"; pages: "151-8" COMMENT SGRef: number: 2; type: "Journal Article" FEATURES Location/Qualifiers source 1..3784 /mol_type="other DNA" /organism="synthetic DNA construct" terminator complement(60..96) /label=soxR terminator /note="bidirectional E. coli soxR transcription terminator" rep_origin 102..871 /label=pBBR1 oriV /note="replication origin of the broad-host-range plasmid pBBR1 from Bordetella bronchiseptica; requires the pBBR1 Rep protein for replication" CDS 872..1531 /codon_start=1 /label=pBBR1 Rep /note="replication protein for the broad-host-range plasmid pBBR1 from Bordetella bronchiseptica" /translation="MATQSREIGIQAKNKPGHWVQTERKAHEAWAGLIARKPTAAMLLH HLVAQMGHQNAVVVSQKTLSKLIGRSLRTVQYAVKDLVAERWISVVKLNGPGTVSAYVV NDRVAWGQPRDQLRLSVFSAAVVVDHDDQDESLLGHGDLRRIPTLYPGEQQLPTGPGEE PPSQPGIPGMEPDLPALTETEEWERRGQQRLPMPDEPCFLDDGEPLEPPTRVTLPRR" CDS 1631..2488 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESLRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLATIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGSLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" terminator complement(2507..2538) /label=tonB terminator /note="bidirectional E. coli tonB-P14 transcription terminator" CDS complement(2569..3444) /codon_start=1 /label=araC /note="L-arabinose regulatory protein" /translation="MAEAQNDPLLPGYSFNAHLVAGLTPIEANGYLDFFIDRPLGMKGY ILNLTIRGQGVVKNQGREFVCRPGDILLFPPGEIHHYGRHPEAREWYHQWVYFRPRAYW HEWLNWPSIFANTGFFRPDEAHQPHFSDLFGQIINAGQGEGRYSELLAINLLEQLLLRR MEAINESLHPPMDNRVREACQYISDHLADSNFDIASVAQHVCLSPSRLSHLFRQQLGIS VLSWREDQRISQAKLLLSTTRMPIATVGRNVGFDDQLYFSRVFKKCTGASPSEFRAGCE EKVNDVAVKLS" promoter 3471..3755 /label=araBAD promoter /note="promoter of the L-arabinose operon of E. coli; the araC regulatory gene is transcribed in the opposite direction (Guzman et al., 1995)"
This page is informational only.