Basic Vector Information
- Vector Name:
- pSMART LCAmp
- Antibiotic Resistance:
- Ampicillin
- Length:
- 2025 bp
- Type:
- Lucigen Vectors
- Replication origin:
- ori
- Source/Author:
- Lucigen
- Copy Number:
- High copy number
pSMART LCAmp vector Map
pSMART LCAmp vector Sequence
LOCUS 40924_40737 2025 bp DNA circular SYN 01-JAN-1980 DEFINITION Low-copy number vector with an ampicillin resistance marker for efficient blunt cloning of unstable sequences. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 2025) AUTHORS Lucigen TITLE Direct Submission REFERENCE 2 (bases 1 to 2025) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" COMMENT Linearize at HincII to make blunt cloning vector. FEATURES Location/Qualifiers source 1..2025 /mol_type="other DNA" /organism="synthetic DNA construct" terminator 65..96 /label=tonB terminator /note="bidirectional E. coli tonB-P14 transcription terminator" promoter 97..199 /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" CDS 200..1057 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="[TEM beta-lactamase fragment, 45 aa] ELDLNSGKILESLRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLATIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGSLLRSA [TEM beta-lactamase fragment, 59 aa] LIKHW" CDS 1061..1249 /codon_start=1 /label=rop /note="Rop protein, which maintains plasmids at low copy number" /translation="VTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA DELYRSCLARFGDDGENL" terminator 1276..1303 /label=T7Te terminator /note="phage T7 early transcription terminator" rep_origin complement(1315..1902) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" terminator complement(1924..1953) /label=T3Te terminator /note="phage T3 early transcription terminator"
This page is informational only.