Basic Vector Information
- Vector Name:
- pCMV-Script EX
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4307 bp
- Type:
- Mammalian Expression Vectors
- Replication origin:
- ori
- Source/Author:
- Agilent Technologies
- Selection Marker:
- Neomycin/G418(Geneticin)
- Copy Number:
- High copy number
- Promoter:
- CMV
pCMV-Script EX vector Map
pCMV-Script EX vector Sequence
LOCUS 40924_11750 4307 bp DNA circular SYN 01-JAN-1980 DEFINITION Phagemid vector for high-level expression of proteins in mammalian cells. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4307) AUTHORS Agilent Technologies TITLE Direct Submission REFERENCE 2 (bases 1 to 4307) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" FEATURES Location/Qualifiers source 1..4307 /mol_type="other DNA" /organism="synthetic DNA construct" enhancer 67..370 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" promoter 371..574 /label=CMV promoter /note="human cytomegalovirus (CMV) immediate early promoter" promoter 620..638 /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" misc_feature 651..758 /label=MCS /note="pBluescript multiple cloning site" promoter complement(780..798) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" polyA_signal 1072..1193 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" rep_origin complement(1229..1684) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 1711..1815 /label=AmpR promoter promoter 1817..2174 /label=SV40 promoter /note="SV40 enhancer and early promoter" CDS 2209..3000 /codon_start=1 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF" polyA_signal 3235..3282 /label=HSV TK poly(A) signal /note="herpes simplex virus thymidine kinase polyadenylation signal (Cole and Stacy, 1985)" rep_origin 3611..4199 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.