Basic Vector Information
- Vector Name:
- pEF1α-IRES-ZsGreen1
- Antibiotic Resistance:
- Kanamycin
- Length:
- 6040 bp
- Type:
- Mammalian Expression Vectors
- Replication origin:
- ori
- Source/Author:
- Clontech
- Selection Marker:
- Neomycin/G418(Geneticin)
- Copy Number:
- High copy number
- Promoter:
- EF-1α
pEF1α-IRES-ZsGreen1 vector Map
pEF1α-IRES-ZsGreen1 vector Sequence
LOCUS 40924_16905 6040 bp DNA circular SYN 01-JAN-1980 DEFINITION IRES-containing bicistronic vector for expressing a gene together with the ZsGreen1 fluorescent protein. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6040) AUTHORS Clontech TITLE Direct Submission REFERENCE 2 (bases 1 to 6040) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" COMMENT The gene inserted into the MCS should contain start and stop codons. FEATURES Location/Qualifiers source 1..6040 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 165..1346 /label=EF-1-alpha promoter /note="strong constitutive promoter for human elongation factor EF-1-alpha" misc_feature 1357..1422 /label=MCS /note="multiple cloning site" misc_feature 1424..2010 /label=IRES2 /note="internal ribosome entry site (IRES) of the encephalomyocarditis virus (EMCV)" CDS 2011..2703 /codon_start=1 /label=ZsGreen1 /note="Zoanthus green fluorescent protein" /translation="MAQSKHGLTKEMTMKYRMEGCVDGHKFVITGEGIGYPFKGKQAIN LCVVEGGPLPFAEDILSAAFMYGNRVFTEYPQDIVDYFKNSCPAGYTWDRSFLFEDGAV CICNADITVSVEENCMYHESKFYGVNFPADGPVMKKMTDNWEPSCEKIIPVPKQGILKG DVSMYLLLKDGGRLRCQFDTVYKAKSVPRKMPDWHFIQHKLTREDRSDAKNQKWHLTEH AIASGSALP" polyA_signal 2828..2949 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" rep_origin complement(2956..3411) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 3438..3542 /label=AmpR promoter promoter 3544..3901 /label=SV40 promoter /note="SV40 enhancer and early promoter" CDS 3936..4727 /codon_start=1 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF" polyA_signal 4962..5009 /label=HSV TK poly(A) signal /note="herpes simplex virus thymidine kinase polyadenylation signal (Cole and Stacy, 1985)" rep_origin 5338..5926 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.