Basic Vector Information
- Vector Name:
- pF4K CMV
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4118 bp
- Type:
- Mammalian Expression Vectors
- Replication origin:
- ori
- Source/Author:
- Promega
- Selection Marker:
- Neomycin/G418(Geneticin)
- Copy Number:
- High copy number
- Promoter:
- CMV
pF4K CMV vector Map
pF4K CMV vector Sequence
LOCUS 40924_19071 4118 bp DNA circular SYN 01-JAN-1980 DEFINITION Flexi(R) vector with a kanamycin resistance marker, for protein expression in mammalian cells. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4118) AUTHORS Promega TITLE Direct Submission REFERENCE 2 (bases 1 to 4118) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" COMMENT Subclone a coding sequence between the SgfI/AsiSI and PmeI sites to remove the lethal barnase gene. FEATURES Location/Qualifiers source 1..4118 /mol_type="other DNA" /organism="synthetic DNA construct" enhancer 139..517 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" promoter 518..721 /label=CMV promoter /note="human cytomegalovirus (CMV) immediate early promoter" intron 857..989 /label=chimeric intron /note="chimera between introns from human beta-globin and immunoglobulin heavy chain genes" promoter 1033..1051 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" CDS 1087..1419 /codon_start=1 /label=barnase /note="ribonuclease from Bacillus amyloliquefaciens" /translation="MAQVINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLAD VAPGKSIGGDIFSNREGKLQGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHY QTFTKIR" misc_feature 1432..1487 /label=MCS /note="pUC18/19 multiple cloning site" polyA_signal complement(1592..1713) /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" CDS 2112..2903 /codon_start=1 /label=NeoR/KanR /note="aminoglycoside phosphotransferase from Tn5" /translation="MLEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ GLAPAELFARLKARMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF" rep_origin complement(3078..3666) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature 3782..4065 /label=cer region /note="ColE1-derived recombination site that helps to maintain plasmids as monomers"
This page is informational only.