Basic Vector Information
- Vector Name:
- pFN24K HaloTag CMVd3
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4128 bp
- Type:
- Mammalian Expression Vectors
- Replication origin:
- ori
- Source/Author:
- Promega
- Selection Marker:
- Neomycin/G418(Geneticin)
- Copy Number:
- High copy number
- Promoter:
- SP6
pFN24K HaloTag CMVd3 vector Map
pFN24K HaloTag CMVd3 vector Sequence
LOCUS 40924_20341 4128 bp DNA circular SYN 01-JAN-1980 DEFINITION Flexi(R) vector with a kanamycin resistance marker, for mammalian expression from a strongly compromised CMV promoter of a protein with an N-terminal HaloTag(R). ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4128) AUTHORS Promega TITLE Direct Submission REFERENCE 2 (bases 1 to 4128) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" COMMENT Subclone a coding sequence between the SgfI/AsiSI and PmeI sites to remove the lethal barnase gene. FEATURES Location/Qualifiers source 1..4128 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 1..45 /label=CMVd3 promoter /note="truncated human cytomegalovirus (CMV) immediate early promoter that yields strongly reduced expression relative to the full-length promoter" promoter 77..95 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" promoter 101..119 /label=SP6 promoter /note="promoter for bacteriophage SP6 RNA polymerase" CDS 136..1026 /codon_start=1 /label=HaloTag(R) /note="modified bacterial dehalogenase that forms covalent bonds with chloroalkane derivatives" /translation="MAEIGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSS YVWRNIIPHVAPTHRCIAPDLIGMGKSDKPDLGYFFDDHVRFMDAFIEALGLEEVVLVI HDWGSALGFHWAKRNPERVKGIAFMEFIRPIPTWDEWPEFARETFQAFRTTDVGRKLII DQNVFIEGTLPMGVVRPLTEVEMDHYREPFLNPVDREPLWRFPNELPIAGEPANIVALV EEYMDWLHQSPVPKLLFWGTPGVLIPPAEAARLAKSLPNCKAVDIGPGLNLLQEDNPDL IGSEIARWLSTLEISG" CDS 1039..1059 /codon_start=1 /label=TEV site /note="tobacco etch virus (TEV) protease recognition and cleavage site" /translation="EDLYFQS" CDS 1097..1429 /codon_start=1 /label=barnase /note="ribonuclease from Bacillus amyloliquefaciens" /translation="MAQVINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLAD VAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHY QTFTKIR" misc_feature 1442..1497 /label=MCS /note="pUC18/19 multiple cloning site" polyA_signal complement(1602..1723) /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" CDS 2122..2913 /codon_start=1 /label=NeoR/KanR /note="aminoglycoside phosphotransferase from Tn5" /translation="MLEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ GLAPAELFARLKARMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF" rep_origin complement(3088..3676) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature 3792..4075 /label=cer region /note="ColE1-derived recombination site that helps to maintain plasmids as monomers"
This page is informational only.