Basic Vector Information
- Vector Name:
- phCMV3
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4251 bp
- Type:
- Mammalian Expression Vectors
- Replication origin:
- ori
- Source/Author:
- MoBiTec
- Selection Marker:
- Neomycin/G418(Geneticin)
- Copy Number:
- High copy number
phCMV3 vector Map
phCMV3 vector Sequence
LOCUS 40924_24353 4251 bp DNA circular SYN 01-JAN-1980 DEFINITION Compact mammalian cell vector for high-level expression of C-terminally HA-tagged proteins. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4251) AUTHORS MoBiTec TITLE Direct Submission REFERENCE 2 (bases 1 to 4251) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" FEATURES Location/Qualifiers source 1..4251 /mol_type="other DNA" /organism="synthetic DNA construct" enhancer 61..364 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" promoter 365..568 /label=CMV promoter /note="human cytomegalovirus (CMV) immediate early promoter" intron 704..813 /label=CMV intron /note="modified intron A from human cytomegalovirus (CMV)" misc_feature 833..889 /label=MCS /note="multiple cloning site" CDS 890..916 /codon_start=1 /label=HA /note="HA (human influenza hemagglutinin) epitope tag" /translation="YPYDVPDYA" polyA_signal 1039..1160 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" rep_origin complement(1167..1622) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 1649..1753 /label=AmpR promoter promoter 1755..2112 /label=SV40 promoter /note="SV40 enhancer and early promoter" CDS 2147..2938 /codon_start=1 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF" polyA_signal 3173..3220 /label=HSV TK poly(A) signal /note="herpes simplex virus thymidine kinase polyadenylation signal (Cole and Stacy, 1985)" rep_origin 3549..4137 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.