Basic Vector Information
- Vector Name:
- pHet-1
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5329 bp
- Type:
- Mammalian Expression Vectors
- Replication origin:
- ori
- Source/Author:
- Clontech
- Copy Number:
- High copy number
- Promoter:
- SV40
pHet-1 vector Map
pHet-1 vector Sequence
LOCUS pHet-1. 5329 bp DNA circular SYN 01-JAN-1980 DEFINITION Mammalian vector encoding an FRB heterodimerizer domain, for creating soluble fusion proteins that can be dimerized with a drug. Also known as pC4-RHE. ACCESSION . VERSION . KEYWORDS pHet-1 SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5329) AUTHORS Clontech TITLE Direct Submission REFERENCE 2 (bases 1 to 5329) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" COMMENT Clone into the XbaI site to fuse DmrC to the C-terminus of the partner protein, or into the SpeI site to fuse DmrC to the N-terminus of the partner protein. FEATURES Location/Qualifiers source 1..5329 /mol_type="other DNA" /organism="synthetic DNA construct" enhancer 19..322 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" promoter 323..526 /label=CMV promoter /note="human cytomegalovirus (CMV) immediate early promoter" 5'UTR 616..655 /label=HSV TK 5'-UTR /note="5' untranslated region from the herpes simplex virus thymidine kinase gene" CDS 676..678 /codon_start=1 /product="start codon" /label=start codon /note="ATG" /translation="M" CDS 688..966 /label=FRB /note="FKBP-rapamycin binding domain of human FRAP" CDS 973..999 /label=HA /note="HA (human influenza hemagglutinin) epitope tag" intron 1031..1603 /label=beta-globin intron /note="intron from rabbit beta-globin gene" polyA_signal 1800..1855 /label=beta-globin poly(A) signal /note="rabbit beta-globin polyadenylation signal (Gil and Proudfoot, 1987)" rep_origin complement(2208..2343) /direction=LEFT /label=SV40 ori /note="SV40 origin of replication" rep_origin complement(2620..3208) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(3379..4251) /codon_start=1 /product="beta-lactamase" /label=beta-lactamase /note="AmpR" /note="confers resistance to ampicillin, carbenicillin, and related antibiotics" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFQVEVAMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDL VEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTR LDRWEPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPL LRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAE IGASLIKHW" promoter complement(4252..4356) /label=AmpR promoter rep_origin complement(4688..5143) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" primer_bind 5288..5304 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 5311..5329 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase"
This page is informational only.