Basic Vector Information
- Vector Name:
- pHet-Act1-2
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8202 bp
- Type:
- Mammalian Expression Vectors
- Replication origin:
- ori
- Source/Author:
- Clontech
- Copy Number:
- High copy number
- Promoter:
- SV40
pHet-Act1-2 vector Vector Map
pHet-Act1-2 vector Sequence
LOCUS pHet-Act1-2. 8202 bp DNA circular SYN 01-JAN-1980 DEFINITION Mammalian vector encoding a transcription factor activation domain and a DNA-binding domain that can be assembled by drug-induced heterodimerization. ACCESSION . VERSION . KEYWORDS pHet-Act1-2 SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 8202) AUTHORS Clontech TITLE Direct Submission REFERENCE 2 (bases 1 to 8202) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" FEATURES Location/Qualifiers source 1..8202 /mol_type="other DNA" /organism="synthetic DNA construct" enhancer 139..517 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" promoter 518..729 /label=CMV promoter /note="human cytomegalovirus (CMV) immediate early promoter" intron 890..1022 /label=chimeric intron /note="chimera between introns from human beta-globin and immunoglobulin heavy chain genes" promoter 1067..1085 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" CDS 1102..1104 /codon_start=1 /product="start codon" /label=start codon /note="ATG" /translation="M" CDS 1114..1392 /label=FRB /note="FKBP-rapamycin binding domain of human FRAP" CDS 1600..1971 /label=RelA (p65) AD /note="transcriptional activation domain of human RelA, also known as p65 (O'Shea and Perkins, 2008)" misc_feature 2040..2626 /label=IRES2 /note="internal ribosome entry site (IRES) of the encephalomyocarditis virus (EMCV)" CDS 2647..2649 /codon_start=1 /product="start codon" /label=start codon /note="ATG" /translation="M" CDS 2656..2682 /label=c-myc NLS /note="nuclear localization signal of human c-Myc proto-oncogene (Dang and Lee, 1988)" CDS 2689..3051 /label=ZFHD1 (DNA binding domain) /note="composite human DNA-binding domain composed of domains from the transcription factors Zif268 and Oct-1 (Pomerantz et al., 1995)" CDS 3058..3378 /label=FKBP /note="human FK506-binding protein FKBP12" CDS 3388..3705 /codon_start=1 /product="human FK506-binding protein FKBP12" /note="FKBP (DmrA)" /translation="VQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPF KFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLK LE" CDS 3712..4032 /codon_start=1 /product="human FK506-binding protein FKBP12" /note="FKBP (DmrA)" /translation="GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKP FKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELL KLE" polyA_signal complement(4101..4222) /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" rep_origin 4408..4863 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 4980..5337 /label=SV40 promoter /note="SV40 enhancer and early promoter" CDS 5388..5984 /label=PuroR /note="puromycin N-acetyltransferase" polyA_signal 6051..6099 /label=poly(A) signal /note="synthetic polyadenylation signal" promoter 6405..6509 /label=AmpR promoter CDS 6510..7367 /label=AmpR /note="beta-lactamase" rep_origin 7541..8129 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.