Basic Vector Information
- Vector Name:
- pHet-Mem1
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5726 bp
- Type:
- Mammalian Expression Vectors
- Replication origin:
- ori
- Source/Author:
- Clontech
- Copy Number:
- High copy number
- Promoter:
- SV40
pHet-Mem1 vector Map
pHet-Mem1 vector Sequence
LOCUS pHet-Mem1. 5726 bp DNA circular SYN 01-JAN-1980 DEFINITION Mammalian vector encoding FKBP heterodimerizer domains, for creating membrane-associated fusion proteins that can be dimerized with a drug. Also known as pC4M-F2E. ACCESSION . VERSION . KEYWORDS pHet-Mem1 SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5726) AUTHORS Clontech TITLE Direct Submission REFERENCE 2 (bases 1 to 5726) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" COMMENT Clone into the XbaI site to fuse the DmrA domains to the C-terminus of the partner protein, or into the SpeI site to fuse the DmrA domains to the N-terminus of the partner protein. FEATURES Location/Qualifiers source 1..5726 /mol_type="other DNA" /organism="synthetic DNA construct" enhancer 19..322 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" promoter 323..526 /label=CMV promoter /note="human cytomegalovirus (CMV) immediate early promoter" 5'UTR 616..655 /label=HSV TK 5'-UTR /note="5' untranslated region from the herpes simplex virus thymidine kinase gene" CDS 668..709 /label=myr /note="N-myristoylation signal from Src kinase (Pellman et al., 1985; Kaplan et al., 1988)" CDS 716..1036 /label=FKBP /note="human FK506-binding protein FKBP12" CDS 1043..1363 /codon_start=1 /product="human FK506-binding protein FKBP12" /label=human FK506-binding protein FKBP12 /note="FKBP (DmrA)" /note="synthetic gene with alternative codons" /translation="GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKP FKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELL KLE" CDS 1370..1396 /label=HA /note="HA (human influenza hemagglutinin) epitope tag" intron 1428..2000 /label=beta-globin intron /note="intron from rabbit beta-globin gene" polyA_signal 2197..2252 /label=beta-globin poly(A) signal /note="rabbit beta-globin polyadenylation signal (Gil and Proudfoot, 1987)" rep_origin complement(2605..2740) /direction=LEFT /label=SV40 ori /note="SV40 origin of replication" rep_origin complement(3017..3605) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(3776..4648) /codon_start=1 /product="beta-lactamase" /label=beta-lactamase /note="AmpR" /note="confers resistance to ampicillin, carbenicillin, and related antibiotics" /translation="[TEM beta-lactamase fragment, 45 aa] ELDLNSGKILESFRPEERFQVEVAMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDL VEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTR LDRWEPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPL LRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAE IGASLIKHW" promoter complement(4649..4753) /label=AmpR promoter rep_origin complement(5085..5540) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" primer_bind 5685..5701 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 5708..5726 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase"
This page is informational only.