Basic Vector Information
- Vector Name:
- pHet-Nuc1
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5410 bp
- Type:
- Mammalian Expression Vectors
- Replication origin:
- ori
- Source/Author:
- Clontech
- Copy Number:
- High copy number
- Promoter:
- SV40
pHet-Nuc1 vector Vector Map
pHet-Nuc1 vector Sequence
LOCUS pHet-Nuc1. 5410 bp DNA circular SYN 01-JAN-1980 DEFINITION Mammalian vector encoding an FKBP heterodimerizer domain, for creating soluble fusion proteins that can be dimerized with a drug. Also known as pC4EN-F1. ACCESSION . VERSION . KEYWORDS pHet-Nuc1 SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5410) AUTHORS Clontech TITLE Direct Submission REFERENCE 2 (bases 1 to 5410) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" COMMENT Clone into the XbaI site to fuse DmrA to the C-terminus of the partner protein, or into the SpeI site to fuse DmrA to the N-terminus of the partner protein. FEATURES Location/Qualifiers source 1..5410 /mol_type="other DNA" /organism="synthetic DNA construct" enhancer 19..322 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" promoter 323..526 /label=CMV promoter /note="human cytomegalovirus (CMV) immediate early promoter" 5'UTR 616..655 /label=HSV TK 5'-UTR /note="5' untranslated region from the herpes simplex virus thymidine kinase gene" CDS 673..675 /codon_start=1 /product="start codon" /label=start codon /note="ATG" /translation="M" CDS 685..711 /label=HA /note="HA (human influenza hemagglutinin) epitope tag" CDS 733..753 /label=SV40 NLS /note="nuclear localization signal of SV40 (simian virus 40) large T antigen" CDS 760..1080 /label=FKBP /note="human FK506-binding protein FKBP12" intron 1112..1684 /label=beta-globin intron /note="intron from rabbit beta-globin gene" polyA_signal 1881..1936 /label=beta-globin poly(A) signal /note="rabbit beta-globin polyadenylation signal (Gil and Proudfoot, 1987)" rep_origin complement(2289..2424) /direction=LEFT /label=SV40 ori /note="SV40 origin of replication" rep_origin complement(2701..3289) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(3460..4332) /codon_start=1 /product="beta-lactamase" /label=beta-lactamase /note="AmpR" /note="confers resistance to ampicillin, carbenicillin, and related antibiotics" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFQVEVAMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDL VEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTR LDRWEPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPL LRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAE IGASLIKHW" promoter complement(4333..4437) /label=AmpR promoter rep_origin complement(4769..5224) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" primer_bind 5369..5385 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 5392..5410 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase"
This page is informational only.