pHom-1 vector (V011113)

LOCUS       pHom-1.        5371 bp DNA     circular SYN 01-JAN-1980
DEFINITION  Mammalian vector encoding an FKBP homodimerizer domain, for creating
            soluble fusion proteins that can be dimerized with a drug. Also 
            known as pC4-FV1E.
ACCESSION   .
VERSION     .
KEYWORDS    pHom-1
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 5371)
  AUTHORS   Clontech
  TITLE     Direct Submission
REFERENCE   2  (bases 1 to 5371)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"
COMMENT     Clone into the XbaI site to fuse DmrB to the C-terminus of the 
            partner protein, or into the SpeI site to fuse DmrB to the 
            N-terminus of the partner protein.
FEATURES             Location/Qualifiers
     source          1..5371
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     enhancer        19..322
                     /label=CMV enhancer
                     /note="human cytomegalovirus immediate early enhancer"
     promoter        323..526
                     /label=CMV promoter
                     /note="human cytomegalovirus (CMV) immediate early
                     promoter"
     5'UTR           616..655
                     /label=HSV TK 5'-UTR
                     /note="5' untranslated region from the herpes simplex virus
                     thymidine kinase gene"
     CDS             676..678
                     /codon_start=1
                     /product="start codon"
                     /label=start codon
                     /note="ATG"
                     /translation="M"
     CDS             688..1008
                     /label=DmrB
                     /note="F36V mutant of FK506-binding protein FKBP12"
     CDS             1015..1041
                     /label=HA
                     /note="HA (human influenza hemagglutinin) epitope tag"
     intron          1073..1645
                     /label=beta-globin intron
                     /note="intron from rabbit beta-globin gene"
     polyA_signal    1842..1897
                     /label=beta-globin poly(A) signal
                     /note="rabbit beta-globin polyadenylation signal (Gil and 
                     Proudfoot, 1987)"
     rep_origin      complement(2250..2385)
                     /direction=LEFT
                     /label=SV40 ori
                     /note="SV40 origin of replication"
     rep_origin      complement(2662..3250)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(3421..4293)
                     /codon_start=1
                     /product="beta-lactamase"
                     /label=beta-lactamase
                     /note="AmpR"
                     /note="confers resistance to ampicillin, carbenicillin, and
                     related antibiotics"
                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
                     ELDLNSGKILESFRPEERFQVEVAMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDL
                     VEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTR
                     LDRWEPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPL
                     LRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAE
                     IGASLIKHW"
     promoter        complement(4294..4398)
                     /label=AmpR promoter
     rep_origin      complement(4730..5185)
                     /direction=LEFT
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     primer_bind     5330..5346
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        5353..5371
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"