Basic Vector Information
- Vector Name:
- pHom-1
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5371 bp
- Type:
- Mammalian Expression Vectors
- Replication origin:
- ori
- Source/Author:
- Clontech
- Copy Number:
- High copy number
- Promoter:
- SV40
pHom-1 vector Vector Map
pHom-1 vector Sequence
LOCUS pHom-1. 5371 bp DNA circular SYN 01-JAN-1980 DEFINITION Mammalian vector encoding an FKBP homodimerizer domain, for creating soluble fusion proteins that can be dimerized with a drug. Also known as pC4-FV1E. ACCESSION . VERSION . KEYWORDS pHom-1 SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5371) AUTHORS Clontech TITLE Direct Submission REFERENCE 2 (bases 1 to 5371) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" COMMENT Clone into the XbaI site to fuse DmrB to the C-terminus of the partner protein, or into the SpeI site to fuse DmrB to the N-terminus of the partner protein. FEATURES Location/Qualifiers source 1..5371 /mol_type="other DNA" /organism="synthetic DNA construct" enhancer 19..322 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" promoter 323..526 /label=CMV promoter /note="human cytomegalovirus (CMV) immediate early promoter" 5'UTR 616..655 /label=HSV TK 5'-UTR /note="5' untranslated region from the herpes simplex virus thymidine kinase gene" CDS 676..678 /codon_start=1 /product="start codon" /label=start codon /note="ATG" /translation="M" CDS 688..1008 /label=DmrB /note="F36V mutant of FK506-binding protein FKBP12" CDS 1015..1041 /label=HA /note="HA (human influenza hemagglutinin) epitope tag" intron 1073..1645 /label=beta-globin intron /note="intron from rabbit beta-globin gene" polyA_signal 1842..1897 /label=beta-globin poly(A) signal /note="rabbit beta-globin polyadenylation signal (Gil and Proudfoot, 1987)" rep_origin complement(2250..2385) /direction=LEFT /label=SV40 ori /note="SV40 origin of replication" rep_origin complement(2662..3250) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(3421..4293) /codon_start=1 /product="beta-lactamase" /label=beta-lactamase /note="AmpR" /note="confers resistance to ampicillin, carbenicillin, and related antibiotics" /translation="[TEM beta-lactamase fragment, 45 aa] ELDLNSGKILESFRPEERFQVEVAMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDL VEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTR LDRWEPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPL LRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAE IGASLIKHW" promoter complement(4294..4398) /label=AmpR promoter rep_origin complement(4730..5185) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" primer_bind 5330..5346 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 5353..5371 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase"
This page is informational only.