Basic Vector Information
- Vector Name:
- pPTuner
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4322 bp
- Type:
- Mammalian Expression Vectors
- Replication origin:
- ori
- Source/Author:
- Clontech
- Selection Marker:
- Neomycin/G418(Geneticin)
- Copy Number:
- High copy number
- Promoter:
- CMV
pPTuner vector Vector Map
pPTuner vector Sequence
LOCUS 40924_35638 4322 bp DNA circular SYN 01-JAN-1980 DEFINITION Vector for fusing a destabilization domain to the N-terminus of a partner protein. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4322) AUTHORS Clontech TITLE Direct Submission REFERENCE 2 (bases 1 to 4322) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" FEATURES Location/Qualifiers source 1..4322 /mol_type="other DNA" /organism="synthetic DNA construct" enhancer 61..364 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" promoter 365..568 /label=CMV promoter /note="human cytomegalovirus (CMV) immediate early promoter" CDS 606..929 /codon_start=1 /label=DD /note="destabilization domain that can be stabilized by Shield1 in the ProteoTuner(TM) system" /translation="MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKVDSSRDRNK PFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVEL LKPE" misc_feature 930..986 /label=MCS /note="multiple cloning site" polyA_signal 1110..1231 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" rep_origin complement(1238..1693) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 1720..1824 /label=AmpR promoter promoter 1826..2183 /label=SV40 promoter /note="SV40 enhancer and early promoter" CDS 2218..3009 /codon_start=1 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF" polyA_signal 3244..3291 /label=HSV TK poly(A) signal /note="herpes simplex virus thymidine kinase polyadenylation signal (Cole and Stacy, 1985)" rep_origin 3620..4208 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.