Basic Vector Information
- Vector Name:
- prHom-1
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5698 bp
- Type:
- Mammalian Expression Vectors
- Replication origin:
- ori
- Source/Author:
- Clontech
- Copy Number:
- High copy number
- Promoter:
- SV40
prHom-1 vector Vector Map
prHom-1 vector Sequence
LOCUS prHom-1. 5698 bp DNA circular SYN 01-JAN-1980 DEFINITION Mammalian vector encoding two FKBP homodimerizer domains, for creating cytoplasmic oligomers that can be dissociated with a drug. Also known as pC4EN-FM2E. ACCESSION . VERSION . KEYWORDS prHom-1 SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5698) AUTHORS Clontech TITLE Direct Submission REFERENCE 2 (bases 1 to 5698) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" COMMENT Clone into the XbaI site to fuse two copies of DmrD to the C-terminus of the partner protein. FEATURES Location/Qualifiers source 1..5698 /mol_type="other DNA" /organism="synthetic DNA construct" enhancer 19..322 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" promoter 323..526 /label=CMV promoter /note="human cytomegalovirus (CMV) immediate early promoter" 5'UTR 616..655 /label=HSV TK 5'-UTR /note="5' untranslated region from the herpes simplex virus thymidine kinase gene" CDS 676..678 /codon_start=1 /product="start codon" /label=start codon /note="ATG" /translation="M" CDS 688..1008 /label=DmrD /note="dimeric F36M mutant of FK506-binding protein FKBP12" CDS 1015..1335 /codon_start=1 /product="dimeric F36M mutant of FK506-binding protein FKBP12" /label=dimeric F36M mutant of FK506-binding protein FK /note="DmrD" /note="dimerization can be reversed by ligand binding" /translation="GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKMDSSRDRNKP FKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELL KLE" CDS 1342..1368 /label=HA /note="HA (human influenza hemagglutinin) epitope tag" intron 1400..1972 /label=beta-globin intron /note="intron from rabbit beta-globin gene" polyA_signal 2169..2224 /label=beta-globin poly(A) signal /note="rabbit beta-globin polyadenylation signal (Gil and Proudfoot, 1987)" rep_origin complement(2577..2712) /direction=LEFT /label=SV40 ori /note="SV40 origin of replication" rep_origin complement(2989..3577) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(3748..4620) /codon_start=1 /product="beta-lactamase" /label=beta-lactamase /note="AmpR" /note="confers resistance to ampicillin, carbenicillin, and related antibiotics" /translation="[TEM beta-lactamase fragment, 45 aa] ELDLNSGKILESFRPEERFQVEVAMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDL VEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTR LDRWEPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPL LRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAE IGASLIKHW" promoter complement(4621..4725) /label=AmpR promoter rep_origin complement(5057..5512) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" primer_bind 5657..5673 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 5680..5698 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase"
This page is informational only.