Basic Vector Information
- Vector Name:
- pTK-neo
- Antibiotic Resistance:
- Kanamycin
- Length:
- 2872 bp
- Type:
- Mammalian Expression Vectors
- Replication origin:
- ori
- Source/Author:
- Novagen (EMD Millipore)
- Selection Marker:
- Neomycin/G418(Geneticin)
- Copy Number:
- High copy number
- Promoter:
- HSV TK
pTK-neo vector Map
pTK-neo vector Sequence
LOCUS 40924_43508 2872 bp DNA circular SYN 01-JAN-1980 DEFINITION Mammalian vector encoding a neomycin resistance gene, to select for stable integration of a cotransfected expression plasmid. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 2872) AUTHORS Novagen (EMD Millipore) TITLE Direct Submission REFERENCE 2 (bases 1 to 2872) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" FEATURES Location/Qualifiers source 1..2872 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 604..749 /label=HSV TK promoter /note="herpes simplex virus thymidine kinase promoter" CDS 816..1607 /codon_start=1 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF" polyA_signal 1842..1889 /label=HSV TK poly(A) signal /note="herpes simplex virus thymidine kinase polyadenylation signal (Cole and Stacy, 1985)" rep_origin 2218..2806 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" promoter 2870..2872 /label=HSV TK promoter /note="herpes simplex virus thymidine kinase promoter"
This page is informational only.