Basic Vector Information
- Vector Name:
- pZFHD1-2
- Antibiotic Resistance:
- Kanamycin
- Length:
- 3991 bp
- Type:
- Mammalian Expression Vectors
- Replication origin:
- ori
- Source/Author:
- Clontech
- Selection Marker:
- Neomycin/G418(Geneticin)
- Copy Number:
- High copy number
- Promoter:
- SV40
pZFHD1-2 vector Map
pZFHD1-2 vector Sequence
LOCUS 40924_48383 3991 bp DNA circular SYN 01-JAN-1980 DEFINITION Mammalian vector encoding a promoter that can be activated by drug-induced heterodimerization of ZFHD1 and the p65 activation domain. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3991) AUTHORS Clontech TITLE Direct Submission REFERENCE 2 (bases 1 to 3991) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" FEATURES Location/Qualifiers source 1..3991 /mol_type="other DNA" /organism="synthetic DNA construct" protein_bind 88..297 /label=12 ZFHD1 binding sites /bound_moiety="ZFHD1" /note="ZFHD1 binding sites" /note="12 binding sites for the composite human DNA-binding domain ZFHD1 (Pomerantz et al., 1995)" promoter 320..433 /label=IL-2 promoter /note="minimal promoter from the human interleukin-2 gene" misc_feature 462..505 /label=MCS /note="MCS" /note="multiple cloning site" polyA_signal 619..740 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" rep_origin complement(747..1202) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 1229..1333 /label=AmpR promoter promoter 1335..1692 /label=SV40 promoter /note="SV40 enhancer and early promoter" CDS 1727..2518 /codon_start=1 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF" polyA_signal 2753..2800 /label=HSV TK poly(A) signal /note="herpes simplex virus thymidine kinase polyadenylation signal (Cole and Stacy, 1985)" rep_origin 3129..3717 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" polyA_signal 3779..3827 /label=poly(A) signal /note="synthetic polyadenylation signal" misc_feature 3841..3932 /label=pause site /note="RNA polymerase II transcriptional pause signal from the human alpha-2 globin gene"
This page is informational only.