pZFHD1-2 vector (Cat. No.: V011043)
Basic Information
- Name:
- pZFHD1-2
- Antibiotic Resistance:
- Kanamycin
- Length:
- 3991 bp
- Type:
- Mammalian Expression Vectors
- Replication origin:
- ori
- Source/Author:
- Clontech
- Selection Marker:
- Neomycin/G418(Geneticin)
- Copy Number:
- High copy number
- Promoter:
- SV40
pZFHD1-2 vector (Cat. No.: V011043) Sequence
LOCUS 40924_48383 3991 bp DNA circular SYN 01-JAN-1980
DEFINITION Mammalian vector encoding a promoter that can be activated by
drug-induced heterodimerization of ZFHD1 and the p65 activation
domain.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 3991)
AUTHORS Clontech
TITLE Direct Submission
REFERENCE 2 (bases 1 to 3991)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..3991
/mol_type="other DNA"
/organism="synthetic DNA construct"
protein_bind 88..297
/label=12 ZFHD1 binding sites
/bound_moiety="ZFHD1"
/note="ZFHD1 binding sites"
/note="12 binding sites for the composite human DNA-binding
domain ZFHD1 (Pomerantz et al., 1995)"
promoter 320..433
/label=IL-2 promoter
/note="minimal promoter from the human interleukin-2 gene"
misc_feature 462..505
/label=MCS
/note="MCS"
/note="multiple cloning site"
polyA_signal 619..740
/label=SV40 poly(A) signal
/note="SV40 polyadenylation signal"
rep_origin complement(747..1202)
/direction=LEFT
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
promoter 1229..1333
/label=AmpR promoter
promoter 1335..1692
/label=SV40 promoter
/note="SV40 enhancer and early promoter"
CDS 1727..2518
/codon_start=1
/label=NeoR/KanR
/note="aminoglycoside phosphotransferase"
/translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP
VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS
SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ
GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA
LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"
polyA_signal 2753..2800
/label=HSV TK poly(A) signal
/note="herpes simplex virus thymidine kinase
polyadenylation signal (Cole and Stacy, 1985)"
rep_origin 3129..3717
/direction=RIGHT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
polyA_signal 3779..3827
/label=poly(A) signal
/note="synthetic polyadenylation signal"
misc_feature 3841..3932
/label=pause site
/note="RNA polymerase II transcriptional pause signal from
the human alpha-2 globin gene"
This page is informational only.