Price Information
| Cat No. | Plasmid Name | Availability | Add to cart |
|---|---|---|---|
| V011022 | pET-21b(+) | In stock, instant shipping |
Buy one, get one free! |
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.
Basic Vector Information
- Vector Name:
- pET-21b(+)
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5438 bp
- Type:
- pET & Duet Vectors (Novagen)
- Replication origin:
- ori
- Source/Author:
- Novagen (EMD Millipore)
- Copy Number:
- High copy number
- Growth Strain(s):
- stbl3
- Growth Temperature:
- 37℃
pET-21b(+) vector Map
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
References
- Shams MH, Assarehzadegan MA, Eskandari N, Masjedi M, Kheirandish F, Ghasemi R, Ganjalikhani Hakemi M, Varzi AM, Safari M, Sohrabi SM, Abdoli Sereshki H. Molecular and immunochemical characterization of Pop n 2: A new allergen of Populus nigra pollen. Clin Exp Allergy. 2021 Dec;51(12):1613-1623. doi: 10.1111/cea.13789. Epub 2021 Jan 26. PMID: 33210791.
- Rahimnahal S, Meimandipour A, Fayazi J, Asghar Karkhane A, Shamsara M, Beigi Nassiri M, Mirzaei H, Hamblin MR, Tarrahimofrad H, Bakherad H, Zamani J, Mohammadi Y. Biochemical and molecular characterization of novel keratinolytic protease from Bacillus licheniformis (KRLr1). Front Microbiol. 2023 May 10;14:1132760. doi: 10.3389/fmicb.2023.1132760. PMID: 37234543; PMCID: PMC10206251.
- Vakili Moghaddam M, Fallahpour M, Mohammadi M, Rasi Varaee FS, Mokhtarian K, Khoshmirsafa M, Jafari R, Shirzad N, Falak R. Identification of polcalcin as a novel allergen of Amaranthus retroflexus pollen. Allergol Immunopathol (Madr). 2019 Jul-Aug;47(4):357-364. doi: 10.1016/j.aller.2018.12.006. Epub 2019 Feb 13. PMID: 30770138.
- Khademi F, Yousefi-Avarvand A, Derakhshan M, Meshkat Z, Tafaghodi M, Ghazvini K, Aryan E, Sankian M. Mycobacterium tuberculosis HspX/EsxS Fusion Protein: Gene Cloning, Protein Expression, and Purification in Escherichia coli. Rep Biochem Mol Biol. 2017 Oct;6(1):15-21. PMID: 29090225; PMCID: PMC5643456.
pET-21b(+) vector Sequence
LOCUS Exported 5438 bp DNA circular SYN 03-SEP-2024
DEFINITION synthetic circular DNA
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 5438)
AUTHORS .
TITLE Direct Submission
FEATURES Location/Qualifiers
source 1..5438
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter 131..149
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
protein_bind 150..174
/label=lac operator
/bound_moiety="lac repressor encoded by lacI"
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
RBS 189..211
/note="efficient ribosome binding site from bacteriophage
T7 gene 10 (Olins and Rangwala, 1989)"
CDS 219..251
/codon_start=1
/product="leader peptide from bacteriophage T7 gene 10"
/label=T7 tag (gene 10 leader)
/note="promotes efficient translation in E. coli"
/translation="MASMTGGQQMG"
CDS 300..317
/codon_start=1
/product="6xHis affinity tag"
/label=6xHis
/translation="HHHHHH"
terminator 384..431
/label=T7 terminator
/note="transcription terminator for bacteriophage T7 RNA
polymerase"
rep_origin 468..923
/direction=RIGHT
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
promoter 949..1053
/gene="bla"
/label=AmpR promoter
CDS 1054..1914
/codon_start=1
/gene="bla"
/product="beta-lactamase"
/label=AmpR
/note="confers resistance to ampicillin, carbenicillin, and
related antibiotics"
/translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS
PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
LIKHW"
rep_origin 2085..2673
/direction=RIGHT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
misc_feature 2859..2998
/label=bom
/note="basis of mobility region from pBR322"
CDS complement(3100..3291)
/codon_start=1
/gene="rop"
/product="Rop protein, which maintains plasmids at low copy
number"
/label=rop
/translation="MTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA
DELYRSCLARFGDDGENL"
CDS complement(4100..5182)
/codon_start=1
/gene="lacI"
/product="lac repressor"
/label=lacI
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
/translation="MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL
NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV
EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH
EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA
MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC
YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR
ALADSLMQLARQVSRLESGQ"
promoter complement(5183..5260)
/gene="lacI"
/label=lacI promoter