Basic Vector Information
- Vector Name:
- pLysE
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 4886 bp
- Type:
- pET & Duet Vectors (Novagen)
- Replication origin:
- p15A ori
- Source/Author:
- Novagen (EMD Millipore)
- Copy Number:
- Medium copy number
pLysE vector Map
pLysE vector Sequence
LOCUS 40924_29531 4886 bp DNA circular SYN 01-JAN-1980 DEFINITION Plasmid for expressing high levels of T7 lysozyme, an inhibitor of T7 RNA polymerase. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4886) AUTHORS Novagen (EMD Millipore) TITLE Direct Submission REFERENCE 2 (bases 1 to 4886) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" COMMENT Expression of the T7 lysozyme gene is driven by the tet promoter. FEATURES Location/Qualifiers source 1..4886 /mol_type="other DNA" /organism="synthetic DNA construct" promoter complement(220..322) /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" rep_origin complement(848..1392) /direction=LEFT /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." promoter 1504..1532 /label=tet promoter /note="E. coli promoter for tetracycline efflux protein gene" CDS 1918..2370 /codon_start=1 /label=T7 lysozyme /note="lysozyme from bacteriophage T7" /translation="MARVQFKQRESTDAIFVHCSATKPSQNVGVREIRQWHKEQGWLDV GYHFIIKRDGTVEAGRDEMAVGSHAKGYNHNSIGVCLVGGIDDKGKFDANFTPAQMQSL RSLLVTLLAKYEGAGLRAHHEVAPKACPSFDLKRWWEKNELVTSDRG" promoter 2371..2404 /label=T7 Phi-3.8 promoter /note="weak promoter for bacteriophage T7 RNA polymerase" CDS complement(join(4449..4886,1..219)) /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"
This page is informational only.