Basic Vector Information
- Vector Name:
- pRI 910
- Antibiotic Resistance:
- Kanamycin
- Length:
- 9168 bp
- Type:
- Plant Vectors
- Replication origin:
- ori
- Host:
- Plants
- Source/Author:
- TaKaRa
- Selection Marker:
- Neomycin/G418(Geneticin)
- Copy Number:
- High copy number
- Promoter:
- NOS
- 5' Primer:
- M13 fwd
- 3' Primer:
- M13 rev
pRI 910 vector Map
pRI 910 vector Sequence
LOCUS 40924_37063 9168 bp DNA circular SYN 01-JAN-1980 DEFINITION Agrobacterium binary vector with a multiple cloning site (MCS), for plant cell transformation. The MCS is reversed in pRI 909. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 9168) AUTHORS TaKaRa TITLE Direct Submission REFERENCE 2 (bases 1 to 9168) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" FEATURES Location/Qualifiers source 1..9168 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin complement(57..645) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature 889..5524 /label=pRi replicator region /note="replicator region from Agrobacterium plasmid pRiA 4b" misc_feature 5531..5555 /label=LB T-DNA repeat /note="left border repeat from nopaline C58 T-DNA" terminator complement(5893..6145) /label=NOS terminator /note="nopaline synthase terminator and poly(A) signal" CDS complement(6422..7210) /codon_start=1 /label=NeoR/KanR /note="aminoglycoside phosphotransferase from Tn5" /translation="IEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRPV LFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLSS HLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQG LAPAELFARLKARMPDGDDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIAL ATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF" promoter complement(7234..7417) /label=NOS promoter /note="nopaline synthase promoter" protein_bind 7584..7605 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 7620..7650 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 7658..7674 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 7682..7698 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" misc_feature 7708..7764 /label=MCS /note="pUC18/19 multiple cloning site" primer_bind complement(7768..7784) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" misc_feature 7899..7923 /label=RB T-DNA repeat /note="right border repeat from nopaline C58 T-DNA" CDS complement(8010..8801) /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MAKMRISPELKKLIEKYRCVKDTEGMSPAKVYKLVGENENLYLKM TDSRYKGTTYDVEREKDMMLWLEGKLPVPKVLHFERHDGWSNLLMSEADGVLCSEEYED EQSPEKIIELYAECIRLFHSIDISDCPYTNSLDSRLAELDYLLNNDLADVDCENWEEDT PFKDPRELYDFLKTEKPEEELVFSHGDLGDSNIFVKDGKVSGFIDLGRSGRADKWYDIA FCVRSIREDIGEEQYVELFFDLLGIKPDWEKIKYYILLDELF"
This page is informational only.