Basic Vector Information
- Vector Name:
- pSB11
- Antibiotic Resistance:
- Streptomycin
- Length:
- 6323 bp
- Type:
- Plant Vectors
- Replication origin:
- ori
- Source/Author:
- Komari T, Hiei Y, Saito Y, Murai N, Kumashiro T.
- Copy Number:
- High copy number
pSB11 vector Map
pSB11 vector Sequence
LOCUS pSB11. 6323 bp DNA circular SYN 01-JAN-1980 DEFINITION Superbinary intermediate vector for plant cell transformation, with a spectinomycin-resistance gene. ACCESSION . VERSION . KEYWORDS pSB11 SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6323) AUTHORS Komari T, Hiei Y, Saito Y, Murai N, Kumashiro T. TITLE Vectors carrying two separate T-DNAs for co-transformation of higher plants mediated by Agrobacterium tumefaciens and segregation of transformants free from selection markers. JOURNAL Plant J. 1996;10:165-74. PUBMED 8758986 REFERENCE 2 (bases 1 to 6323) TITLE Direct Submission REFERENCE 3 (bases 1 to 6323) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Plant J."; date: "1996"; volume: "10"; pages: "165-74" COMMENT SGRef: number: 2; type: "Journal Article" COMMENT Homologous recombination with the acceptor vector occurs in the region spanning the cos and bom sites. FEATURES Location/Qualifiers source 1..6323 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature 1..51 /label=MCS /note="MCS" /note="multiple cloning site" misc_feature complement(104..128) /label=LB T-DNA repeat /note="left border repeat from nopaline C58 T-DNA" CDS complement(1304..2092) /codon_start=1 /gene="aadA" /product="aminoglycoside adenylyltransferase" /label=aadA /note="SmR" /note="confers resistance to spectinomycin and streptomycin" /translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP VILEARQAYLGQEDRLASRADQLEEFVHYVKGEITKVVGK" CDS complement(2150..2674) /codon_start=1 /product="streptothricin acetyltransferase" /label=streptothricin acetyltransferase /note="streptothricin acetyltransferase" /translation="MKISVIPEQVAETLDAENHFIVREVFDVHLSDQGFELSTRSVSPY RKDYISDDDSDEDSACYGAFIDQELVGKIELNSTWNDLASIEHIVVSHTHRGKGVAHSL IEFAKKWALSRQLLGIRLETQTNNVPACNLYAKCGFTLGGIDLFTYKTRPQVSNETAMY WYWFSGAQDDA" misc_feature 3073..3213 /label=bom /note="basis of mobility region from pBR322" rep_origin complement(3399..3987) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature 4495..4893 /label=cos /note="lambda cos site; allows packaging into phage lambda particles" promoter complement(5456..5560) /label=AmpR promoter misc_feature complement(6147..6171) /label=RB T-DNA repeat /note="right border repeat from nopaline C58 T-DNA"
This page is informational only.