Basic Vector Information
- Vector Name:
- pMCSG58
- Antibiotic Resistance:
- Ampicillin
- Length:
- 4748 bp
- Type:
- Structural Genomics Vectors
- Replication origin:
- ori
- Source/Author:
- Eschenfeldt WH, Makowska-Grzyska M, Stols L, Donnelly MI,
- Copy Number:
- High copy number
pMCSG58 vector Map
pMCSG58 vector Sequence
LOCUS 40924_30286 4748 bp DNA circular SYN 01-JAN-1980
DEFINITION Compact bacterial vector encoding tRNA genes for rare Arg and Ile
codons, with a C-terminal 6xHis tag for high-throughput purification
of recombinant proteins.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 4748)
AUTHORS Eschenfeldt WH, Makowska-Grzyska M, Stols L, Donnelly MI,
Jedrzejczak R, Joachimiak A.
TITLE New LIC vectors for production of proteins from genes containing
rare codons.
JOURNAL J. Struct. Funct. Genomics 2013;14:135-44.
PUBMED 24057978
REFERENCE 2 (bases 1 to 4748)
AUTHORS Eschenfeldt WH, Maltseva N, Stols L, Donnelly MI, Gu M, Nocek B, Tan
K, Kim Y, Joachimiak A.
TITLE Cleavable C-terminal His-tag vectors for structure determination.
JOURNAL J. Struct. Funct. Genomics 2010;11:31-9.
PUBMED 20213425
REFERENCE 3 (bases 1 to 4748)
AUTHORS Midwest Center for Structural Genomics
TITLE Direct Submission
REFERENCE 4 (bases 1 to 4748)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "J. Struct.
Funct. Genomics"; date: "2013"; volume: "14"; pages: "135-44"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "J. Struct.
Funct. Genomics"; date: "2010"; volume: "11"; pages: "31-9"
COMMENT SGRef: number: 3; type: "Journal Article"
COMMENT For ligation-independent cloning (LIC), linearize with SmaI and
treat with T4 DNA polymerase plus dATP.
FEATURES Location/Qualifiers
source 1..4748
/mol_type="other DNA"
/organism="synthetic DNA construct"
terminator complement(26..73)
/label=T7 terminator
/note="transcription terminator for bacteriophage T7 RNA
polymerase"
CDS complement(140..157)
/codon_start=1
/label=6xHis
/note="6xHis affinity tag"
/translation="HHHHHH"
CDS complement(208..225)
/codon_start=1
/label=6xHis
/note="6xHis affinity tag"
/translation="HHHHHH"
RBS complement(237..257)
/label=RBS
/note="efficient ribosome binding site from bacteriophage
T7 gene 10 (Olins and Rangwala, 1989)"
protein_bind complement(273..297)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(298..316)
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
tRNA complement(591..667)
/label=argU
tRNA complement(937..1012)
/label=ileX
promoter 1152..1229
/label=lacI promoter
CDS 1230..2309
/codon_start=1
/label=lacI
/note="lac repressor"
/translation="VKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL
NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV
EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH
EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA
MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC
YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR
ALADSLMQLARQVSRLESGQ"
protein_bind 2325..2346
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
rep_origin complement(2741..3329)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(3503..4360)
/codon_start=1
/label=AmpR
/note="beta-lactamase"
/translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS
PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
LIKHW"
promoter complement(4361..4464)
/label=AmpR promoter
This page is informational only.