Basic Vector Information
- Vector Name:
- pNIC-CH
- Antibiotic Resistance:
- Kanamycin
- Length:
- 7218 bp
- Type:
- Structural Genomics Vectors
- Replication origin:
- ori
- Source/Author:
- Savitsky P, Bray J, Cooper CD, Marsden BD, Mahajan P, Burgess-Brown
- Copy Number:
- High copy number
- Promoter:
- sacB
pNIC-CH vector Vector Map
pNIC-CH vector Sequence
LOCUS 40924_33217 7218 bp DNA circular SYN 18-DEC-2018 DEFINITION Expression vector pNIC-CH, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7218) AUTHORS Gileadi O, Burgess-Brown N, Loppnau P. TITLE Vectors for Ligation-independent Cloning (LIC) JOURNAL Unpublished REFERENCE 2 (bases 1 to 7218) AUTHORS Gileadi O, Burgess-Brown N. TITLE Direct Submission JOURNAL Submitted (27-DEC-2006) Structural Genomics Consortium, University of Oxford, Botnar Research Centre, Oxford OX3 7LD, UK REFERENCE 3 (bases 1 to 7218) TITLE Direct Submission REFERENCE 4 (bases 1 to 7218) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (27-DEC-2006) Structural Genomics Consortium, University of Oxford, Botnar Research Centre, Oxford OX3 7LD, UK" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..7218 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 253..271 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" protein_bind 272..296 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." RBS 311..333 /label=RBS /note="efficient ribosome binding site from bacteriophage T7 gene 10 (Olins and Rangwala, 1989)" promoter 348..780 /label=sacB promoter /note="sacB promoter and control region" CDS 781..2199 /codon_start=1 /label=SacB /note="secreted levansucrase that renders bacterial growth sensitive to sucrose" /translation="MNIKKFAKQATVLTFTTALLAGGATQAFAKETNQKPYKETYGISH ITRHDMLQIPEQQKNEKYKVPEFDSSTIKNISSAKGLDVWDSWPLQNTDGTVANYHGYH IVFALAGDPKNADDTSIYMFYQKVGETSIDSWKNAGRVFKDSDKFDANDSILKDQTQEW SGSATFTSDGKIRLFYTDFSGKHYGKQTLTTAQVNVSASDSSLNINGVEDYKSIFDGDG KTYQNVQQFIDEGNYSSGDNHTLRDPHYVEDKGHKYLVFEANTGTEDGYQGEESLFNKA YYGKSTSFFRQESQKLLQSDKKRTAELANGALGMIELNDDYTLKKVMKPLIASNTVTDE IERANVFKMNGKWYLFTDSRGSKMTIDGITSNDIYMLGYVSNSLTGPYKPLNKTGLVLK MDLDPNDVTFTYSHFAVPQAKGNNVVITSYMTNRGFYADKQSTFAPSFLLNIKGKKTSV VKDSILEQGQLTVNK" CDS 2264..2281 /codon_start=1 /label=6xHis /note="6xHis affinity tag" /translation="HHHHHH" CDS 2331..2348 /codon_start=1 /label=6xHis /note="6xHis affinity tag" /translation="HHHHHH" terminator 2415..2462 /label=T7 terminator /note="transcription terminator for bacteriophage T7 RNA polymerase" rep_origin 2499..2954 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" CDS complement(3050..3862) /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" rep_origin 3984..4572 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(4758..4900) /label=bom /note="basis of mobility region from pBR322" CDS complement(5005..5193) /codon_start=1 /label=rop /note="Rop protein, which maintains plasmids at low copy number" /translation="VTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA DELYRSCLARFGDDGENL" protein_bind complement(5968..5989) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." CDS complement(6005..7084) /codon_start=1 /label=lacI /note="lac repressor" /translation="VKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR ALADSLMQLARQVSRLESGQ" promoter complement(7085..7162) /label=lacI promoter
This page is informational only.