pLVX-Het-Mem1 vector (V010437)

Download GeneBank File(.gb)

LOCUS       V010437                 9268 bp    DNA     circular SYN 01-JAN-1980
DEFINITION  Exported.
ACCESSION   V010437
VERSION     V010437
KEYWORDS    pLVX-Het-Mem1
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 9268)
  AUTHORS   Clontech
  TITLE     Direct Submission
REFERENCE   2  (bases 1 to 9268)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"
            The N-myristoylation signal must be at the N-terminus of the fusion
            protein.
FEATURES             Location/Qualifiers
     source          1..9268
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     LTR             1..634
                     /label="3' LTR"
                     /note="3' long terminal repeat (LTR) from HIV-1"
     misc_feature    681..806
                     /label="HIV-1 Psi"
                     /note="packaging signal of human immunodeficiency virus
                     type 1"
     misc_feature    1303..1536
                     /label="RRE"
                     /note="The Rev response element (RRE) of HIV-1 allows for
                     Rev-dependent mRNA export from the nucleus to the
                     cytoplasm."
     CDS             1721..1765
                     /label="gp41 peptide"
                     /note="antigenic peptide corresponding to amino acids 655
                     to 669 of the HIV envelope protein gp41 (Lutje Hulsik et
                     al., 2013)"
     CDS             1914..1955
                     /note="Protein Tat from Human immunodeficiency virus type 1
                     group M subtype B (isolate WMJ22). Accession#: P12509"
                     /label="Protein Tat"
     misc_feature    2027..2144
                     /label="cPPT/CTS"
                     /note="central polypurine tract and central termination
                     sequence of HIV-1"
     enhancer        2201..2504
                     /label="CMV enhancer"
                     /note="human cytomegalovirus immediate early enhancer"
     promoter        2505..2708
                     /label="CMV promoter"
                     /note="human cytomegalovirus (CMV) immediate early
                     promoter"
     misc_feature    2810..2821
                     /label="5' MCS"
                     /note="5' MCS"
                     /note="multiple cloning site upstream of DmrA"
     CDS             2822..2863
                     /label="myr"
                     /note="N-myristoylation signal from Src kinase (Pellman et
                     al., 1985; Kaplan et al., 1988)"
     CDS             2870..3190
                     /label="FKBP"
                     /note="human FK506-binding protein FKBP12"
     CDS             3197..3517
                     /codon_start=1
                     /product="human FK506-binding protein FKBP12"
                     /label="human FK506-binding protein FKBP12"
                     /note="FKBP (DmrA)"
                     /note="synthetic gene with alternative codons"
                     /translation="GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKP
                     FKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELL
                     KLE"
     misc_feature    3519..3532
                     /label="3' MCS"
                     /note="3' MCS"
                     /note="multiple cloning site downstream of DmrA"
     misc_feature    3545..4131
                     /label="IRES2"
                     /note="internal ribosome entry site (IRES) of the
                     encephalomyocarditis virus (EMCV)"
     CDS             4157..5173
                     /label="HygR"
                     /note="aminoglycoside phosphotransferase from E. coli"
     misc_feature    5190..5778
                     /label="WPRE"
                     /note="woodchuck hepatitis virus posttranscriptional
                     regulatory element"
     LTR             5986..6619
                     /label="5' LTR"
                     /note="5' long terminal repeat (LTR) from HIV-1"
     primer_bind     complement(6748..6764)
                     /label="M13 rev"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     protein_bind    complement(6772..6788)
                     /label="lac operator"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be
                     relieved by adding lactose or
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(6796..6826)
                     /label="lac promoter"
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(6841..6862)
                     /label="CAP binding site"
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     rep_origin      complement(7150..7735)
                     /direction=LEFT
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     CDS             complement(7909..8766)
                     /label="AmpR"
                     /note="beta-lactamase"
     promoter        complement(8767..8871)
                     /label="AmpR promoter"
     polyA_signal    8919..9053
                     /label="SV40 poly(A) signal"
                     /note="SV40 polyadenylation signal"