Basic Vector Information
- Vector Name:
- pLVX-Het-Mem1
- Antibiotic Resistance:
- Ampicillin
- Length:
- 9268 bp
- Type:
- Viral Expression & Packaging Vectors
- Replication origin:
- ori
- Source/Author:
- Clontech
- Copy Number:
- High copy number
- Promoter:
- CMV
pLVX-Het-Mem1 vector Map
pLVX-Het-Mem1 vector Sequence
LOCUS V010437 9268 bp DNA circular SYN 01-JAN-1980 DEFINITION Exported. ACCESSION V010437 VERSION V010437 KEYWORDS pLVX-Het-Mem1 SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 9268) AUTHORS Clontech TITLE Direct Submission REFERENCE 2 (bases 1 to 9268) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" The N-myristoylation signal must be at the N-terminus of the fusion protein. FEATURES Location/Qualifiers source 1..9268 /mol_type="other DNA" /organism="synthetic DNA construct" LTR 1..634 /label="3' LTR" /note="3' long terminal repeat (LTR) from HIV-1" misc_feature 681..806 /label="HIV-1 Psi" /note="packaging signal of human immunodeficiency virus type 1" misc_feature 1303..1536 /label="RRE" /note="The Rev response element (RRE) of HIV-1 allows for Rev-dependent mRNA export from the nucleus to the cytoplasm." CDS 1721..1765 /label="gp41 peptide" /note="antigenic peptide corresponding to amino acids 655 to 669 of the HIV envelope protein gp41 (Lutje Hulsik et al., 2013)" CDS 1914..1955 /note="Protein Tat from Human immunodeficiency virus type 1 group M subtype B (isolate WMJ22). Accession#: P12509" /label="Protein Tat" misc_feature 2027..2144 /label="cPPT/CTS" /note="central polypurine tract and central termination sequence of HIV-1" enhancer 2201..2504 /label="CMV enhancer" /note="human cytomegalovirus immediate early enhancer" promoter 2505..2708 /label="CMV promoter" /note="human cytomegalovirus (CMV) immediate early promoter" misc_feature 2810..2821 /label="5' MCS" /note="5' MCS" /note="multiple cloning site upstream of DmrA" CDS 2822..2863 /label="myr" /note="N-myristoylation signal from Src kinase (Pellman et al., 1985; Kaplan et al., 1988)" CDS 2870..3190 /label="FKBP" /note="human FK506-binding protein FKBP12" CDS 3197..3517 /codon_start=1 /product="human FK506-binding protein FKBP12" /label="human FK506-binding protein FKBP12" /note="FKBP (DmrA)" /note="synthetic gene with alternative codons" /translation="GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKP FKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELL KLE" misc_feature 3519..3532 /label="3' MCS" /note="3' MCS" /note="multiple cloning site downstream of DmrA" misc_feature 3545..4131 /label="IRES2" /note="internal ribosome entry site (IRES) of the encephalomyocarditis virus (EMCV)" CDS 4157..5173 /label="HygR" /note="aminoglycoside phosphotransferase from E. coli" misc_feature 5190..5778 /label="WPRE" /note="woodchuck hepatitis virus posttranscriptional regulatory element" LTR 5986..6619 /label="5' LTR" /note="5' long terminal repeat (LTR) from HIV-1" primer_bind complement(6748..6764) /label="M13 rev" /note="common sequencing primer, one of multiple similar variants" protein_bind complement(6772..6788) /label="lac operator" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(6796..6826) /label="lac promoter" /note="promoter for the E. coli lac operon" protein_bind complement(6841..6862) /label="CAP binding site" /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(7150..7735) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(7909..8766) /label="AmpR" /note="beta-lactamase" promoter complement(8767..8871) /label="AmpR promoter" polyA_signal 8919..9053 /label="SV40 poly(A) signal" /note="SV40 polyadenylation signal"
This page is informational only.