Basic Vector Information
- Vector Name:
- pDH25
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6993 bp
- Type:
- Yeast Plasmids
- Replication origin:
- ori
- Source/Author:
- Cullen D, Leong SA, Wilson LJ, Henner DJ.
- Copy Number:
- High copy number
- Promoter:
- trpC
pDH25 vector Map
pDH25 vector Sequence
LOCUS 40924_14695 6993 bp DNA circular SYN 01-JAN-1980 DEFINITION Plasmid for transforming fungi to hygromycin resistance. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6993) AUTHORS Cullen D, Leong SA, Wilson LJ, Henner DJ. TITLE Transformation of Aspergillus nidulans with the hygromycin-resistance gene, hph. JOURNAL Gene 1987;57:21-6. PUBMED 3322945 REFERENCE 2 (bases 1 to 6993) TITLE Direct Submission REFERENCE 3 (bases 1 to 6993) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Gene"; date: "1987"; volume: "57"; pages: "21-6" COMMENT SGRef: number: 2; type: "Journal Article" COMMENT A ClaI site is present just upstream of the HygR start codon. FEATURES Location/Qualifiers source 1..6993 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 1540..1728 /codon_start=1 /label=rop /note="Rop protein, which maintains plasmids at low copy number" /translation="VTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA DELYRSCLARFGDDGENL" misc_feature 1833..1973 /label=bom /note="basis of mobility region from pBR322" rep_origin complement(2159..2747) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(2921..3778) /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="[TEM beta-lactamase fragment, 45 aa] ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS [TEM beta-lactamase fragment, 59 aa] EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA [TEM beta-lactamase fragment, 59 aa] LIKHW" promoter complement(3779..3883) /label=AmpR promoter promoter 4874..5230 /label=trpC promoter /note="promoter for Aspergillus nidulans trpC" CDS 5235..6257 /codon_start=1 /label=HygR /note="aminoglycoside phosphotransferase from E. coli" /translation="MKKPELTATSVEKFLIEKFDSVSDLMQLSEGEESRAFSFDVGGRG YVLRVNSCADGFYKDRYVYRHFASAALPIPEVLDIGEFSESLTYCISRRAQGVTLQDLP ETELPAVLQPVAEAMDAIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIADPHVYHWQ TVMDDTVSASVAQALDELMLWAEDCPEVRHLVHADFGSNNVLTDNGRITAVIDWSEAMF GDSQYEVANIFFWRPWLACMEQQTRYFERRHPELAGSPRLRAYMLRIGLDQLYQSLVDG NFDDAAWAQGRCDAIVRSGAGTVGRTQIARRSAAVWTDGCVEVLADSGNRRPSTRPRAK E" terminator 6429..6987 /label=trpC terminator /note="transcription terminator from the Aspergillus nidulans trpC gene"
This page is informational only.