pGAPZ A vector (V010276)

MSDS

Basic Vector Information

Vector Name:: pGAPZ A

Antibiotic Resistance:: Bleomycin

Length:: 2884 bp

Type:: Yeast Plasmids

Replication origin:: ori

Host:: Yeast

Source/Author:: Invitrogen (Life Technologies)

Copy Number:: High copy number

Promoter:: GAP

pGAPZ A vector Vector Map

View Map in NovoBuilder

pGAPZ A vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       40924_21105        2884 bp DNA     circular SYN 13-SEP-2021
DEFINITION  synthetic circular DNA.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 2884)
  TITLE     Direct Submission
REFERENCE   2  (bases 1 to 2884)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..2884
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        7..483
                     /label=GAP promoter
                     /note="promoter for Pichia pastoris
                     glyceraldehyde-3-phosphate dehydrogenase"
     CDS             564..593
                     /codon_start=1
                     /label=Myc
                     /note="Myc (human c-Myc proto-oncogene) epitope tag"
                     /translation="EQKLISEEDL"
     CDS             609..626
                     /codon_start=1
                     /label=6xHis
                     /note="6xHis affinity tag"
                     /translation="HHHHHH"
     terminator      705..951
                     /label=AOX1 terminator
                     /note="transcription terminator for AOX1"
     promoter        966..1377
                     /label=TEF1 promoter
                     /note="promoter for EF-1-alpha"
     promoter        1384..1431
                     /label=EM7 promoter
                     /note="synthetic bacterial promoter"
     CDS             1450..1821
                     /codon_start=1
                     /label=BleoR
                     /note="antibiotic-binding protein"
                     /translation="MAKLTSAVPVLTARDVAGAVEFWTDRLGFSRDFVEDDFAGVVRDD
                     VTLFISAVQDQVVPDNTLAWVWVRGLDELYAEWSEVVSTNFRDASGPAMTEIGEQPWGR
                     EFALRDPAGNCVHFVAEEQD"
     terminator      1890..2137
                     /label=CYC1 terminator
                     /note="transcription terminator for CYC1"
     rep_origin      complement(2212..2800)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"

This page is informational only.