Basic Vector Information
- Vector Name:
- pGAPZ C
- Antibiotic Resistance:
- Bleomycin
- Length:
- 2883 bp
- Type:
- Yeast Plasmids
- Replication origin:
- ori
- Host:
- Yeast
- Source/Author:
- Invitrogen (Life Technologies)
- Copy Number:
- High copy number
- Promoter:
- GAP
pGAPZ C vector Vector Map
pGAPZ C vector Sequence
LOCUS 40924_21115 2883 bp DNA circular SYN 13-SEP-2021 DEFINITION synthetic circular DNA. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 2883) TITLE Direct Submission REFERENCE 2 (bases 1 to 2883) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" FEATURES Location/Qualifiers source 1..2883 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 7..483 /label=GAP promoter /note="promoter for Pichia pastoris glyceraldehyde-3-phosphate dehydrogenase" CDS 563..592 /codon_start=1 /label=Myc /note="Myc (human c-Myc proto-oncogene) epitope tag" /translation="EQKLISEEDL" CDS 608..625 /codon_start=1 /label=6xHis /note="6xHis affinity tag" /translation="HHHHHH" terminator 704..950 /label=AOX1 terminator /note="transcription terminator for AOX1" promoter 965..1376 /label=TEF1 promoter /note="promoter for EF-1-alpha" promoter 1383..1430 /label=EM7 promoter /note="synthetic bacterial promoter" CDS 1449..1820 /codon_start=1 /label=BleoR /note="antibiotic-binding protein" /translation="MAKLTSAVPVLTARDVAGAVEFWTDRLGFSRDFVEDDFAGVVRDD VTLFISAVQDQVVPDNTLAWVWVRGLDELYAEWSEVVSTNFRDASGPAMTEIGEQPWGR EFALRDPAGNCVHFVAEEQD" terminator 1889..2136 /label=CYC1 terminator /note="transcription terminator for CYC1" rep_origin complement(2211..2799) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.