Basic Vector Information
- Vector Name:
- pPIC6 B
- Antibiotic Resistance:
- Blasticidin
- Length:
- 3380 bp
- Type:
- Yeast Plasmids
- Replication origin:
- ori
- Source/Author:
- Invitrogen (Life Technologies)
- Copy Number:
- High copy number
- Promoter:
- AOX1
pPIC6 B vector Vector Map
pPIC6 B vector Sequence
LOCUS 40924_34515 3380 bp DNA circular SYN 13-SEP-2021 DEFINITION synthetic circular DNA. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3380) TITLE Direct Submission REFERENCE 2 (bases 1 to 3380) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" FEATURES Location/Qualifiers source 1..3380 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 2..940 /label=AOX1 promoter /note="inducible promoter, regulated by methanol" CDS 1010..1039 /codon_start=1 /label=Myc /note="Myc (human c-Myc proto-oncogene) epitope tag" /translation="EQKLISEEDL" CDS 1055..1072 /codon_start=1 /label=6xHis /note="6xHis affinity tag" /translation="HHHHHH" terminator 1152..1398 /label=AOX1 terminator /note="transcription terminator for AOX1" promoter 1413..1824 /label=TEF1 promoter /note="promoter for EF-1-alpha" promoter 1832..1879 /label=EM7 promoter /note="synthetic bacterial promoter" CDS 1898..2293 /codon_start=1 /label=BSD /note="blasticidin S deaminase" /translation="MAKPLSQEESTLIERATATINSIPISEDYSVASAALSSDGRIFTG VNVYHFTGGPCAELVVLGTAAAAAAGNLTCIVAIGNENRGILSPCGRCRQVLLDLHPGI KAIVKDSDGQPTAVGIRELLPSGYVWEG" terminator 2390..2637 /label=CYC1 terminator /note="transcription terminator for CYC1" rep_origin complement(2712..3300) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.