pPICZ B vector (Cat. No.: V010243)
Note: The commonly used Pichia pastoris strain for the pPICZ B vector is X33.
- Name:
- pPICZ B
- Antibiotic Resistance:
- Bleomycin
- Length:
- 3329 bp
- Type:
- Yeast Plasmids
- Replication origin:
- ori
- Source/Author:
- Invitrogen (Life Technologies)
- Copy Number:
- High copy number
- Promoter:
- AOX1
- Fusion Tag:
- Myc, 6xHis
- Growth Strain(s):
- JM108
Resources
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add sterile water to dissolve the DNA: add 20 μl for 5 μg plasmid, and 100 μl for 100 μg plasmid.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
References
- Li J, Sun C, Chen L, Sun L, Duan L, Zheng Q, Hu X. Optimization of the secretory expression of recombinant human C-reactive protein in Pichia pastoris. 3 Biotech. 2017 Oct;7(5):291. doi: 10.1007/s13205-017-0917-0. Epub 2017 Aug 29. PMID: 28868218; PMCID: PMC5574733.
- Yan WW, Cui ZZ, Wang YK. [Expression of capsid gene of Chinese isolate of rabbit hemorrhagic disease virus in Pichia pastoris]. Sheng Wu Gong Cheng Xue Bao. 2005 Jan;21(1):135-8. Chinese. PMID: 15859343.
- Huang ZY, Wang YN, Zhu JL, Dong ZL, Chen C. [Expression and purification of membrane immunogens of Treponema pallidum in Pichia pastoris]. Wei Sheng Wu Xue Bao. 2006 Oct;46(5):831-4. Chinese. PMID: 17172039.
- Song KD, Lee WK. Antibacterial Activity of Recombinant Pig Intestinal Parasite Cecropin P4 Peptide Secreted from Pichia pastoris. Asian-Australas J Anim Sci. 2014 Feb;27(2):278-83. doi: 10.5713/ajas.2013.13615. PMID: 25049952; PMCID: PMC4093210.
pPICZ B vector (Cat. No.: V010243) Sequence
LOCUS Exported 3329 bp DNA circular SYN 13-DEC-2024
DEFINITION synthetic circular DNA
ACCESSION .
VERSION .
KEYWORDS pPICZ B
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 3329)
AUTHORS 11111111
TITLE Direct Submission
FEATURES Location/Qualifiers
source 1..3329
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter 2..940
/gene="Pichia pastoris AOX1"
/label=AOX1 promoter
/note="inducible promoter, regulated by methanol"
CDS 1010..1039
/codon_start=1
/product="Myc (human c-Myc oncogene) epitope tag"
/label=Myc
/translation="EQKLISEEDL"
CDS 1055..1072
/codon_start=1
/product="6xHis affinity tag"
/label=6xHis
/translation="HHHHHH"
terminator 1152..1398
/gene="Pichia pastoris AOX1"
/label=AOX1 terminator
/note="transcription terminator for AOX1"
promoter 1419..1826
/gene="S. cerevisiae TEF1"
/label=TEF1 promoter
/note="promoter for EF-1-alpha"
promoter 1833..1880
/label=EM7 promoter
/note="synthetic bacterial promoter "
CDS 1899..2273
/codon_start=1
/gene="Sh ble from Streptoalloteichus hindustanus"
/product="antibiotic-binding protein"
/label=BleoR
/note="confers resistance to bleomycin, phleomycin, and
Zeocin(TM)"
/translation="MAKLTSAVPVLTARDVAGAVEFWTDRLGFSRDFVEDDFAGVVRDD
VTLFISAVQDQVVPDNTLAWVWVRGLDELYAEWSEVVSTNFRDASGPAMTEIGEQPWGR
EFALRDPAGNCVHFVAEEQD"
terminator 2339..2586
/gene="S. cerevisiae CYC1"
/label=CYC1 terminator
/note="transcription terminator for CYC1"
rep_origin complement(2661..3249)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"