Basic Vector Information
- Vector Name:
- pRS415
- Antibiotic Resistance:
- Ampicillin
- Length:
- 7500 bp
- Type:
- Yeast Plasmids
- Replication origin:
- ori
- Host:
- Yeast
- Source/Author:
- Sikorski RS, Hieter P.
- Copy Number:
- High copy number
- Promoter:
- GAL1,10
- 5' Primer:
- M13 fwd
- 3' Primer:
- M13 rev
pRS415 vector Vector Map
pRS415 vector Sequence
LOCUS 40924_37923 7500 bp DNA circular SYN 18-DEC-2018 DEFINITION Shuttle vector pRS415, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7500) AUTHORS Pinto MR, Marchini JF, Buranello PA, Oliver C, Mortara RA, Tosi LR. TITLE The Leishmania major HTBF protein belongs in the YIP family of proteins JOURNAL Unpublished REFERENCE 2 (bases 1 to 7500) AUTHORS Pinto MR, Marchini JF, Tosi LR. TITLE Direct Submission JOURNAL Submitted (13-AUG-2008) Bilogia Celular e Molecular e Bioagentes Patogenicos, Faculdade de Medicina de Ribeirao Preto, AV. Bandeirantes, 3900, Ribeirao Preto, Sao Paulo 14049-900, Brasil REFERENCE 3 (bases 1 to 7500) TITLE Direct Submission REFERENCE 4 (bases 1 to 7500) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (13-AUG-2008) Bilogia Celular e Molecular e Bioagentes Patogenicos, Faculdade de Medicina de Ribeirao Preto, AV. Bandeirantes, 3900, Ribeirao Preto, Sao Paulo 14049-900, Brasil" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..7500 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(666..1757) /label=LEU2 /note="3-isopropylmalate dehydrogenase, required for leucine biosynthesis" promoter complement(1770..2174) /label=LEU2 promoter rep_origin complement(2474..2929) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" primer_bind 3074..3090 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 3100..3118 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind 3144..3160 /label=KS primer /note="common sequencing primer, one of multiple similar variants" regulatory complement(3181..3267) /label=GAL 1 /note="GAL 1" /regulatory_class="promoter" promoter complement(3272..3936) /label=GAL1,10 promoter /note="divergent inducible promoter, regulated by Gal4" regulatory 3948..4088 /label=GAL10 /note="GAL10" /regulatory_class="promoter" CDS 4103..4672 /codon_start=1 /product="HTBF" /label=HTBF /note="H region resistance protein; derived from Leishmania terbinafine" /protein_id="ACH69155.1" /translation="MLNEVHVNADPNSISTLDEPVLETLLRDAKAIGRKLVVVVCPSLG GDKELRDWDLWGPLFLCLILASILTINASDDQGAAVFSAVFIFVWLGGLVVTVNAKLLG SKIMFFQTYCAMGYCLAPICLGALLCCVLPWFLLNLMLCFMAWAWACWAALRFFRHTVS ADREVLVVYPVGLFYVFFTWMVLVGI" primer_bind complement(4673..4689) /label=SK primer /note="common sequencing primer, one of multiple similar variants" promoter complement(4726..4744) /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" primer_bind complement(4765..4781) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(4789..4805) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(4813..4843) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(4858..4879) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(5167..5755) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(5929..6786) /label=AmpR /note="beta-lactamase" promoter complement(6787..6891) /label=AmpR promoter misc_feature 6928..7431 /label=CEN/ARS /note="S. cerevisiae CEN6 centromere fused to an autonomously replicating sequence"
This page is informational only.