Basic Vector Information
- Vector Name:
- pYC2-E
- Antibiotic Resistance:
- Ampicillin
- Length:
- 4489 bp
- Type:
- Yeast Plasmids
- Replication origin:
- ori
- Source/Author:
- Invitrogen (Life Technologies)
- Copy Number:
- High copy number
- Promoter:
- GAL1
pYC2-E vector Map
pYC2-E vector Sequence
LOCUS 40924_47878 4489 bp DNA circular SYN 01-JAN-1980
DEFINITION Centromeric Saccharomyces cerevisiae expression vector that serves
as an acceptor in the Echo(TM) Cloning System.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 4489)
AUTHORS Invitrogen (Life Technologies)
TITLE Direct Submission
REFERENCE 2 (bases 1 to 4489)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..4489
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter 2..443
/label=GAL1 promoter
/note="inducible promoter, regulated by Gal4"
promoter 475..493
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
protein_bind complement(507..540)
/label=loxH
/note="Cre-mediated recombination occurs in the 8-bp core
sequence (ATGTATGC) (Shaw et al., 2021). The loxH variant
was optimized for expression constructs but remains
compatible with loxP."
terminator 571..818
/label=CYC1 terminator
/note="transcription terminator for CYC1"
rep_origin complement(1066..1654)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
misc_feature complement(2123..2501)
/label=ISS
/note="immunostimulatory sequence from the AmpR gene;
contains unmethylated CpG dinucleotides in the context of
5'-AACGTT-3' (Sato et al., 1996)"
CDS complement(2784..3584)
/codon_start=1
/label=URA3
/note="orotidine-5'-phosphate decarboxylase, required for
uracil biosynthesis"
/translation="MSKATYKERAATHPSPVAAKLFNIMHEKQTNLCASLDVRTTKELL
ELVEALGPKICLLKTHVDILTDFSMEGTVKPLKALSAKYNFLLFEDRKFADIGNTVKLQ
YSAGVYRIAEWADITNAHGVVGPGIVSGLKQAAEEVTKEPRGLLMLAELSCKGSLSTGE
YTKGTVDIAKSDKDFVIGFIAQRDMGGRDEGYDWLIMTPGVGLDDKGDALGQQYRTVDD
VVSTGSDIIIVGRGLFAKGRDAKVEGERYRKAGWEAYLRRCGQQN"
promoter complement(3585..3805)
/label=URA3 promoter
misc_feature 3833..4336
/label=CEN/ARS
/note="S. cerevisiae CEN6 centromere fused to an
autonomously replicating sequence"
This page is informational only.