Basic Vector Information
- Vector Name:
- pYES2.1-E
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5825 bp
- Type:
- Yeast Plasmids
- Replication origin:
- ori
- Source/Author:
- Invitrogen (Life Technologies)
- Copy Number:
- High copy number
- Promoter:
- GAL1
pYES2.1-E vector Map
pYES2.1-E vector Sequence
LOCUS 40924_48048 5825 bp DNA circular SYN 01-JAN-1980 DEFINITION High-copy episomal Saccharomyces cerevisiae expression vector that serves as an acceptor in the Echo(TM) Cloning System. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5825) AUTHORS Invitrogen (Life Technologies) TITLE Direct Submission REFERENCE 2 (bases 1 to 5825) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" FEATURES Location/Qualifiers source 1..5825 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 2..443 /label=GAL1 promoter /note="inducible promoter, regulated by Gal4" promoter 475..493 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" protein_bind complement(507..540) /label=loxH /note="Cre-mediated recombination occurs in the 8-bp core sequence (ATGTATGC) (Shaw et al., 2021). The loxH variant was optimized for expression constructs but remains compatible with loxP." terminator 571..818 /label=CYC1 terminator /note="transcription terminator for CYC1" rep_origin complement(1066..1654) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(2123..2501) /label=ISS /note="immunostimulatory sequence from the AmpR gene; contains unmethylated CpG dinucleotides in the context of 5'-AACGTT-3' (Sato et al., 1996)" CDS complement(2784..3584) /codon_start=1 /label=URA3 /note="orotidine-5'-phosphate decarboxylase, required for uracil biosynthesis" /translation="MSKATYKERAATHPSPVAAKLFNIMHEKQTNLCASLDVRTTKELL ELVEALGPKICLLKTHVDILTDFSMEGTVKPLKALSAKYNFLLFEDRKFADIGNTVKLQ YSAGVYRIAEWADITNAHGVVGPGIVSGLKQAAEEVTKEPRGLLMLAELSCKGSLSTGE YTKGTVDIAKSDKDFVIGFIAQRDMGGRDEGYDWLIMTPGVGLDDKGDALGQQYRTVDD VVSTGSDIIIVGRGLFAKGRDAKVEGERYRKAGWEAYLRRCGQQN" promoter complement(3585..3805) /label=URA3 promoter rep_origin complement(4404..5284) /direction=LEFT /label=2u ori /note="yeast 2u plasmid origin of replication" rep_origin complement(5295..5808) /direction=LEFT /label=M13 ori /note="M13 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis"
This page is informational only.