Basic Vector Information
- Vector Name:
- pYM26
- Antibiotic Resistance:
- Ampicillin
- Length:
- 4298 bp
- Type:
- Yeast Plasmids
- Replication origin:
- ori
- Source/Author:
- Janke C, Magiera MM, Rathfelder N, Taxis C, Reber S, Maekawa H,
- Copy Number:
- High copy number
pYM26 vector Map
pYM26 vector Sequence
LOCUS pYM26. 4298 bp DNA circular SYN 01-JAN-1980 DEFINITION Plasmid with a TRP1 marker that provides a template for PCR to fuse yeast enhanced GFP (yeGFP) to the C-terminus of a protein of interest. ACCESSION . VERSION . KEYWORDS pYM26 SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4298) AUTHORS Janke C, Magiera MM, Rathfelder N, Taxis C, Reber S, Maekawa H, Moreno-Borchart A, Doenges G, Schwob E, Schiebel E, Knop M. TITLE A versatile toolbox for PCR-based tagging of yeast genes: new fluorescent proteins, more markers and promoter substitution cassettes. JOURNAL Yeast 2004;21:947-62. PUBMED 15334558 REFERENCE 2 (bases 1 to 4298) AUTHORS EUROSCARF TITLE Direct Submission REFERENCE 3 (bases 1 to 4298) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Yeast"; date: "2004"; volume: "21"; pages: "947-62" COMMENT SGRef: number: 2; type: "Journal Article" FEATURES Location/Qualifiers source 1..4298 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 82..795 /label=yeGFP /note="yeast-enhanced green fluorescent protein" CDS complement(886..1518) /codon_start=1 /gene="Kluyveromyces lactis TRP1" /product="phosphoribosylanthranilate isomerase, required for tryptophan biosynthesis" /label=Kluyveromyces lactis TRP1 /note="KlTRP1" /note="K. lactis auxotrophic marker that also works in S. cerevisiae" /translation="MLVKVCGLQTVEAAKTAVDDGADYLGIICVPGRKRTIDSSVAKGI STAVHQQENVKGTKLVGVFRNQSVDDVLQLYHEYNLDVIQLHGDEDIKEYRSLIPSSIP IIKRFQFPQDCELLLDLYEHVDNVLTLFDSGEGGTGEKLNWSAISSWSASHPEIKFIIA GGLNPDNVSVAINMLPNAIGVDVSGGVETDGIKDLEKVKLFIQQASQ" promoter complement(1936..1954) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" rep_origin complement(2212..2800) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(2974..3831) /label=AmpR /note="beta-lactamase" promoter complement(3832..3936) /label=AmpR promoter promoter 4282..4298 /label=SP6 promoter /note="promoter for bacteriophage SP6 RNA polymerase"
This page is informational only.