Basic Vector Information
- Vector Name:
- pRS314 with TRP1 marker
- Antibiotic Resistance:
- Ampicillin
- Length:
- 4783 bp
- Type:
- Yeast centromere vector
- Replication origin:
- ori
- Source/Author:
- Sikorski RS, Hieter P.
- Promoter:
- TRP1
pRS314 with TRP1 marker vector Vector Map
pRS314 with TRP1 marker vector Sequence
LOCUS 40924_37818 4783 bp DNA circular SYN 18-DEC-2018 DEFINITION Yeast centromere vector pRS314 with TRP1 marker, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4783) AUTHORS Sikorski RS, Hieter P. TITLE A system of shuttle vectors and yeast host strains designed for efficient manipulation of DNA in Saccharomyces cerevisiae JOURNAL Genetics 122 (1), 19-27 (1989) PUBMED 2659436 REFERENCE 2 (bases 1 to 4783) AUTHORS Stillman DJ. TITLE Direct Submission JOURNAL Submitted (10-NOV-1993) David J. Stillman, Dept. of Cellular, Viral and Molecular Biology, University of Utah Medical Center, Salt Lake City, UT 84132, USA REFERENCE 3 (bases 1 to 4783) TITLE Direct Submission REFERENCE 4 (bases 1 to 4783) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Genetics"; date: "1989"; volume: "122"; issue: "1"; pages: "19-27" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (10-NOV-1993) David J. Stillman, Dept. of Cellular, Viral and Molecular Biology, University of Utah Medical Center, Salt Lake City, UT 84132, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..4783 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 187..467 /label=TRP1 promoter CDS 468..1139 /codon_start=1 /label=TRP1 /note="phosphoribosylanthranilate isomerase, required for tryptophan biosynthesis" /translation="MSVINFTGSSGPLVKVCGLQSTEAAECALDSDADLLGIICVPNRK RTIDPVIARKISSLVKAYKNSSGTPKYLVGVFRNQPKEDVLALVNDYGIDIVQLHGDES WQEYQEFLGLPVIKRLVFPKDCNILLSAASQKPHSFIPLFDSEAGGTGELLDWNSISDW VGRQESPESLHFMLAGGLTPENVGDALRLNGVIGVDVSGGVETNGVKDSNKIANFVKNA KK" rep_origin complement(1239..1694) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" primer_bind 1839..1855 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 1862..1880 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" misc_feature 1889..1996 /label=MCS /note="pBluescript multiple cloning site" promoter complement(2009..2027) /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" primer_bind complement(2048..2064) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(2072..2088) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(2096..2126) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(2141..2162) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(2450..3038) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(3212..4069) /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFFHNMGDHVTRLDRW EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" promoter complement(4070..4174) /label=AmpR promoter misc_feature 4211..4714 /label=CEN/ARS /note="S. cerevisiae CEN6 centromere fused to an autonomously replicating sequence"
This page is informational only.