pYPQ141-ZmUbi-RZ-Lb vector (Cat. No.: V005899)
- Name:
- pYPQ141-ZmUbi-RZ-Lb
- Antibiotic Resistance:
- Spectinomycin
- Length:
- 4991 bp
- Type:
- CRISPR
- Replication origin:
- ori
- Copy Number:
- High Copy
- Promoter:
- Maize ubiquitin 1
- Cloning Method:
- Gateway Cloning
- 5' Primer:
- ttcccagtcacgacgttgtaaaac
- 3' Primer:
- catggtcatagctgtttcctg
Resources
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add sterile water to dissolve the DNA: add 20 μl for 5 μg plasmid, and 100 μl for 100 μg plasmid.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
pYPQ141-ZmUbi-RZ-Lb vector (Cat. No.: V005899) Sequence
LOCUS 40924_48233 4991 bp DNA circular SYN 13-MAY-2021
DEFINITION LbCpf1 Gateway gRNA entry plasmid using Zea mays Ubi promoter and
ribozyme processing.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 4991)
AUTHORS Tang X, Lowder LG, Zhang T, Malzahn AA, Zheng X, Voytas DF, Zhong Z,
Chen Y, Ren Q, Li Q, Kirkland ER, Zhang Y, Qi Y
TITLE A CRISPR-Cpf1 system for efficient genome editing and
transcriptional repression in plants.
JOURNAL Nat Plants. 2017 Feb 17;3:17018. doi: 10.1038/nplants.2017.18.
PUBMED 28211909
REFERENCE 2 (bases 1 to 4991)
TITLE Direct Submission
REFERENCE 3 (bases 1 to 4991)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat
Plants."; date: "2017-02-17"; pages: "
10.1038/nplants.2017.18"
COMMENT SGRef: number: 2; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..4991
/mol_type="other DNA"
/organism="synthetic DNA construct"
ncRNA 1040..1076
/label=hammerhead ribozyme
ncRNA 1130..1197
/label=HDV ribozyme
protein_bind complement(1217..1316)
/label=attL2
/note="recombination site for the Gateway(R) LR reaction"
promoter complement(1334..1352)
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
promoter complement(1369..1387)
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
primer_bind complement(1392..1408)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
CDS 1839..2627
/codon_start=1
/label=SmR
/note="aminoglycoside adenylyltransferase (Murphy, 1985)"
/translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH
SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK
RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF
EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP
VILEARQAYLGQEEDRLASRADQLEEFVHYVKGEITKVVGK"
rep_origin 2723..3311
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
primer_bind 3465..3482
/label=L4440
/note="L4440 vector, forward primer"
terminator complement(3641..3668)
/label=rrnB T2 terminator
/note="transcription terminator T2 from the E. coli rrnB
gene"
terminator complement(3760..3846)
/label=rrnB T1 terminator
/note="transcription terminator T1 from the E. coli rrnB
gene"
primer_bind 3910..3926
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
protein_bind 3941..4036
/label=attL5
/note="recombination site for the Gateway(R) LR reaction"
promoter 4048..4991
/label=Ubi promoter
/note="maize polyubiquitin gene promoter"